KEGG   Pelobacter carbinolicus: Pcar_1779Help
Entry
Pcar_1779         CDS       T00285                                 

Gene name
manB-2
Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00010  Glycolysis / Gluconeogenesis
pca00030  Pentose phosphate pathway
pca00051  Fructose and mannose metabolism
pca00052  Galactose metabolism
pca00230  Purine metabolism
pca00500  Starch and sucrose metabolism
pca00520  Amino sugar and nucleotide sugar metabolism
pca00521  Streptomycin biosynthesis
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01120  Microbial metabolism in diverse environments
pca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1779 (manB-2)
   00030 Pentose phosphate pathway
    Pcar_1779 (manB-2)
   00051 Fructose and mannose metabolism
    Pcar_1779 (manB-2)
   00052 Galactose metabolism
    Pcar_1779 (manB-2)
   00500 Starch and sucrose metabolism
    Pcar_1779 (manB-2)
   00520 Amino sugar and nucleotide sugar metabolism
    Pcar_1779 (manB-2)
  Nucleotide metabolism
   00230 Purine metabolism
    Pcar_1779 (manB-2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pcar_1779 (manB-2)
Enzymes [BR:pca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Pcar_1779 (manB-2)
    5.4.2.8  phosphomannomutase
     Pcar_1779 (manB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ABA89022
UniProt: Q3A3N5
Position
complement(2082376..2083728)
Genome map
AA seq 450 aa AA seqDB search
MTNLTCFKAYDIRGRLPDELNEEIAYRIGRSYAEYLKPGRVVVGRDVRLSSAALCDALSN
GLLDGGTDVFDIGLCGTEEIYFATFAEEMDGGIMVTASHNPMDYNGMKLVRQGSRPISGD
SGLDAIRELAQDNQFAPPVQRGTRTVLETRPRYIEHLLGYIDRQSLRPLKIVVNAGNGCA
GPVLDQLEQHLPFEFIKVHHDPDGAFPNGIPNPLLPENRSATAEAVVAHGADLGIAWDGD
FDRCFLFDEKGGFIEGYYVVGLLAAAFLQHHPGARIIHDPRLTWNTMDLVSELGGTAVMS
KTGHAFIKERMRQEDAVYGGEMSAHHYFRDFAYCDSGMIPWLLVTELMSRSGQPLSSLVG
ERIKCYPASGEINRRLSDPAATLSNIENHYRVGAKATDFTDGLSMEFDQWRFNLRCSNTE
PVVRLNVETRGDQGLMEQKTQEILGMMDAR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaacttgctttaaagcctacgacatccgcggtcgtctgccggatgaactc
aacgaggaaatcgcttaccgtatcgggcggtcttatgccgagtatctgaagccgggccgg
gtggtggtgggtcgggatgtgcggctcagcagtgcggctttgtgtgatgcgctgagcaac
gggcttcttgatggtgggacggatgttttcgatatcggtttgtgcggtacggaagagatc
tatttcgccacctttgccgaggagatggatggcggcattatggtgacggccagtcacaat
cccatggattacaacggcatgaaactggtgcggcagggatcgcggcctatcagtggcgac
agtggtctggatgccattcgggagttggctcaggacaaccagtttgctccgccggtacaa
cgcggtacccgcactgttctggagacccggccgcgttatatcgaacatctgctgggctat
atcgaccggcaatcattgcggcctctgaagatcgtggtcaatgccggcaacggttgtgcc
ggtccggtactggatcagctggagcagcatctgccctttgagttcatcaaggtccatcat
gatccggacggtgcctttcccaacggcattcctaatcccctgttgccggaaaacaggtcg
gctacggccgaagcggtggtggcccacggtgcggatctggggattgcctgggatggtgat
tttgatcgttgttttctgttcgacgagaagggtggcttcatcgaggggtattatgtggtg
ggattgctggcggcggcgtttctgcagcaccaccccggagcccgcattatccacgacccc
cgtctgacctggaataccatggatctggtgtcggaactgggcggcacggcggtcatgagc
aagaccggccatgctttcatcaaggaacgcatgcggcaggaagatgcggtgtacggcgga
gagatgagcgctcaccattacttccgggattttgcctactgcgacagcggcatgattccc
tggctgctggtcaccgaactcatgagccgcagtggccagcctctttccagcctggtgggt
gagcggatcaaatgttatcccgccagcggcgagatcaatcgtcgcctgagcgatcccgct
gcaactctgtccaacatcgagaatcattatcgtgtcggtgcgaaagcaaccgattttacg
gatggattgagtatggagttcgatcagtggcggtttaacctgcgctgctccaataccgag
ccggtggtgcggttgaatgtcgaaacccggggtgatcaggggttgatggagcagaagacg
caggaaatcctaggcatgatggatgcgcgttag

DBGET integrated database retrieval system