KEGG   Physeter catodon (sperm whale): 102973458
Entry
102973458         CDS       T06011                                 

Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102973458
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcad04040]
    102973458
Ion channels [BR:pcad04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102973458
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 102973458
NCBI-ProteinID: XP_007107532
UniProt: A0A2Y9ESZ6
Position
Unknown
AA seq 559 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPHQRRQRDNSESEEEGEEKEKEAERKGAREGDLP
TDLVAFASSCTLHGASHIFVEGGPGPRQALWAAAFILALGAFLCQVGDRVAYYLSYPHVT
LLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAF
SGEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRL
KTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAP
GFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtcattctcctctggagaggaggccccagggccc
ttgggagatgtttggggtccccaccagcggcgacagcgggacaactcagaatcagaagag
gagggagaagagaaggaaaaggaggcagagaggaagggggccagagagggggacttaccg
acggacttggtggcctttgccagcagctgcacccttcatggagccagccacatctttgtg
gaagggggtccagggccacggcaggccctgtgggcagcggcctttatcctggcactgggt
gccttcttgtgccaggtcggggatcgagttgcctattacctcagctacccacatgtgact
ctgctagatgaagtggccacgacggagctggccttcccggcggtcaccctctgcaacacc
aatgccgtgcggctgtcccagctcagctatcccgacttgctctacctggcccccatgctg
gggctggatgaaagcgatgaccccggggtgcccctcgccccaccggggcccgaggccttc
tctggggagccctttaacttgcaccgcttctacaatcgctcctgccaccggctggaggac
atgctgctctattgctcctactgcggggggccctgtggccctcacaacttctcagtggtc
ttcacacggtatggaaagtgctacacgttcaactctggccgagatggacgtcccaggctg
aagaccatgaagggtgggacgggcaatgggctggagatcatgctggacattcagcaggac
gagtacctgcccgtgtggggggagaccgatgagacgtccttcgaagcgggcatcaaagtg
cagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggtgtagcccca
gggttccagacctttgtggcctgtcaagagcagcggctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccatggacttggatttcttcgactcctacagcattaccgcc
tgccgcatcgactgtgagacccgctacctggtggagaactgtaactgccgcatggtgcac
atgccaggggatgccccatactgcactccagagcagtacaaggagtgtgcagatcctgcc
ctggacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccctgcaacttg
actcgctatggcaaggagctgtccatggtcaagatccccagcaaagcatcagccaagtac
ctggccaagaagttcaacaagtctgagcagtacataggggagaacatcctggtgctggac
attttctttgaagtcctcaactatgagaccattgagcagaagaaggcctatgagattgca
ggactcctgggtgacattggaggccagatgggtctgttcatcggggccagcatcctcact
gtgctggagctcttcgactacgcctacgaggtgataaaacacaagctgtgcagacgaggc
aagtgccagaaggaggccaaacggagcagcgcggacaagggcgtggccctcagcctggat
gacgtcaaaagacacaacccgtgtgagagtctccggggccatcctgccgggatgacgtat
gctgccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system