KEGG   Physeter catodon (sperm whale): 102973556Help
Entry
102973556         CDS       T06011                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04260  Cardiac muscle contraction
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04921  Oxytocin signaling pathway
pcad05410  Hypertrophic cardiomyopathy (HCM)
pcad05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
pcad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102973556 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102973556 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102973556 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    102973556 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102973556 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102973556 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    102973556 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcad04040]
    102973556 (CACNG5)
Ion channels [BR:pcad04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102973556 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc DUF716
Motif
Other DBs
NCBI-GeneID: 102973556
NCBI-ProteinID: XP_007130890
UniProt: A0A2Y9FUQ4
Position
14
AA seq 275 aa AA seqDB search
MGACRRKALTLLSSVFAVCGLGLLGTAVSTDHWLYLEEGVVLPQNQSTETKMALHSGLWR
VCFLAGEERGRCFTIEYVMPVSAQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHVRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFTYKYGWSFA
FAAISFLLTESAGVMAVYLFMKRCTAEDVYRPHPGFYRPRLSNCSDHSGQFLHPDAWARG
RSPSDISSDVSLQMNSSYPALLKCPDYRQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcctgcaggagaaaggccctgaccctgctgagcagcgtctttgccgtgtgcggc
ctgggcctgctgggcaccgcggtcagcacggaccactggctgtacctggaggagggcgtg
gtcctgccccagaaccagagcaccgagaccaagatggccctgcactcaggcctgtggagg
gtctgcttcctcgcaggtgaggagcggggacgctgcttcaccatagagtatgtgatgcct
gtgagcgcccagctcacctccgagtccacggtcaacgtgctaaaaatgattcgctcggcc
acgccgttccccctggtcagcctcttcttcatgttcatcggcttcatcctgagcaacatt
ggacacgtccgtccccacaggacaatcctggcctttgtctccggcatcttctttatcctc
tccggcctctcgctggtggtgggcctggtgctgtacatctccagcatcaacgatgagatg
ctcaacaggaccaaggatgcggagacctacttcacctacaagtacggatggtcgtttgcc
ttcgctgccatctccttcctcttaacggagagtgcgggggtgatggccgtgtacctgttc
atgaagaggtgcaccgccgaggacgtgtacaggcctcaccccggtttctaccgcccgcgt
ctgagcaactgctcggatcactcgggccagttcctgcacccggacgcctgggcgcgaggc
cgcagcccgtccgacatctccagcgacgtctccctgcagatgaacagcagctacccagcc
ctgctcaagtgccccgactaccgccagatgtcttcctccccctgctga

DBGET integrated database retrieval system