KEGG   Physeter catodon (sperm whale): 102974123Help
Entry
102974123         CDS       T06011                                 

Gene name
MAP4K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102974123 (MAP4K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102974123 (MAP4K4)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102974123 (MAP4K4)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: STE group
  STE20 family
   102974123 (MAP4K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 102974123
NCBI-ProteinID: XP_023972377
UniProt: A0A2Y9S4V4
Position
12
AA seq 1384 aa AA seqDB search
MANDSPAKSLVDIDLSSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYTQRPPTEQLLRHPFIRDQPNERQVRI
QLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQEGEPSSIVNVPGESTLRRDFLRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREAR
RQQEREQRRREQEEKRRLEELERRRKEEEERRRAEEEKRRVEREQECIRRQLEEEQRHLE
LLQQQLLQEQAMLLECRWRELEEHRQTERLQRQLQQEQAYLLSLQHEPRRPPPPPDRSKA
GLHGAEPKAQHEPADRAREVEDRFRKTNHSSPEAQSKQTGRVLEPPVPSRSESFSNGNSE
SVHPALQRPAEPQVQWSHLASLKNSVSPVSRSHSFSDPSPPKFAHHHLRSQDPCPPSRSE
VLSQSSDSKSEVPDPAQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQNSQA
GQRNSTSSIEPRLLWERVEKLVPRPGSGSSSGSSNSGSQPGSHPGSQSGSGERFRVRSSS
KSEGSPSQRLENAAKKPEDKKEVFRPLKPAGEVDLTALARELRAAEDVRPPHKVTDYSSS
SEESGTTDEEDDDVEQEGPEEPTSGPEDARAASSLNLSNGETESVKTMIVHDDVESEPAM
TPSKEGTLIVRQSAIDQKRASHHESNGFAGRIHLLPDLLQQSHSSSTSSTSSSPSSSQPT
PTMSPQTPQDKLTTNETQSASSTLQKHKSSSSFTPFIDPRLLQISPSSGTTVTSVVGFSC
DGMRSEAIRQDPTRKGSVVNVNPTNTRPQSDTPEIRKYKKRFNSEILCAALWGVNLLVGT
ESGLMLLDRSGQGKVYPLINRRRFQQMDVLEGLNVLVTISGKKDKLRVYYLSWLRNKILH
NDPEVEKKQGWTTVGDLEGCVHYKVVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKS
FGDLVHKPLLVDLTVEEGQRLKVIYGSCAGFHAVDVDSGSVYDIYLPTHVRKNPHSMIQC
SIKPHAIIILPNTDGMELLVCYEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQTMG
WGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLGRTS
LLSW
NT seq 4155 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactcccctgcaaaaagtctggtggacatcgacctgtcctccctgcgggat
ccggctgggattttcgagctggtggaagtggtgggaaatggtacctacggacaagtctat
aagggtcgacatgttaaaacaggtcagctggcagccatcaaagttatggatgttactgag
gatgaagaggaggaaatcaagctggagataaatatgctgaagaaatattctcatcataga
aatattgcaacgtattacggtgctttcattaaaaagagccccccaggacacgatgaccaa
ctctggcttgtcatggagttctgcggggccggctccatcacagacctcgtgaagaacacc
aagggcaacacgctcaaggaggactggatagcctacatctcccgggagatcctgagggga
ctggcgcatctccacatccatcatgtgattcaccgggacatcaagggccagaatgtattg
ctgaccgagaacgcagaggtgaagcttgtggacttcggtgtgagcgctcagctggacagg
actgtggggaggagaaacaccttcataggcaccccgtactggatggctcccgaggtcatc
gcctgtgacgagaaccccgacgccacctatgattacaggagtgacctgtggtcctgcggc
atcacagccattgagatggcagaaggcgctccccctctctgtgacatgcatcccatgaga
gcactgtttctcatccccagaaaccctcctccccggctgaagtccaaaaaatggtcaaag
aagttttttagttttatcgaaggctgcctggtgaagaattacacgcagcggccccccaca
gagcagcttctgagacacccttttataagggaccagccaaacgaaaggcaggttagaatc
cagcttaaggaccatatagaccggaccaggaagaagagaggggagaaagatgaaaccgag
tacgagtacagcgggagcgaggaagaggaggaggaggtgccggagcaggagggggagccc
agctccatcgtcaacgtgcctggtgagtccacgctgcgccgggacttcctgaggctgcag
caggagaacaaggaacgctctgaggccctgaggaggcagcagctcctgcaggagcagcag
ctccgggagcaggaagagtataagaggcagctgctggcggagagacaaaagcggatcgag
cagcagaaagaacagaggcgacggctggaagagcaacaaaggagagagcgggaagccaga
aggcagcaggaacgtgagcagcggaggcgggaacaggaggagaagaggcggctggaggag
ctggagaggcggcggaaggaagaggaggagcggaggcgggcggaggaggagaagaggaga
gttgaaagggagcaggagtgtatcaggcggcagctggaagaggaacagcggcacctggaa
ctccttcagcagcagttgctccaggagcaggccatgctactggagtgccgctggcgggag
ctggaggagcaccggcagacagagcggctccagaggcagctgcagcaggaacaggcctat
ctcctgtctctacagcatgagccccggaggccgcccccgccgccggacaggagcaaggcc
ggcctgcacggcgccgagcctaaggcccagcacgagcccgccgaccgggcccgcgaggtg
gaagatagatttaggaaaactaaccacagctcccctgaagcccagtctaagcagacaggc
agagtattggagccgccagtgccttccagatcagagtctttttccaatggcaactccgag
tctgtgcaccctgccctgcagagaccagccgagccacaggtacagtggtcccacctggca
tctctcaagaacagtgtttcccctgtctcgcgatcccattccttcagtgacccttctcct
cccaaatttgcacaccaccatcttcgctctcaggacccatgtccaccttcccgcagtgag
gtgctaagtcagagttctgactctaagtcggaggtacccgaccccgcccaaaaggcttgg
tctagatcagacagtgacgaggtgcctccaagggttcctgtgagaacgacgtcccggtcc
cccgtcctgtcccgtcgggattccccgctgcagggcagtgggcagcaaaatagccaagca
ggtcagagaaactccaccagcagcatcgagcccaggctgctctgggagagagtggagaag
ctggtgcccaggcctggcagtggcagctcctcggggtccagcaactcaggatcccagccc
ggctcccaccctgggtctcagagcggctccggggagcgcttcagagtgagatcatcatcc
aaatctgagggctcgccatctcagcgccttgaaaatgcagcaaaaaagcctgaagataaa
aaggaagtttttagacctctcaagcccgctggcgaagtggacctgacggccctggccaga
gagctccgagcggcggaagacgtgcggccgccgcacaaggtgacagactactcctcgtcc
agtgaggagtccgggacgacggacgaggaagacgacgacgtggagcaggaagggcccgag
gagcccacctcggggccggaggacgccagagccgcgtcatctctgaacttgagcaacggt
gagacggagtccgtgaaaaccatgatcgtccacgacgacgtggagagtgagccagccatg
acgccgtccaaggagggcaccctgatcgtccgccagagtgcaattgaccaaaagcgcgcc
agccatcatgagagcaatggctttgccggtcgcattcacctcttgccagatctcttacag
caaagccattcctcctccacttcctccacctcctcctccccatcctccagccagccgaca
cccaccatgtccccacagacaccccaggacaagctcactactaatgagactcagtccgct
agtagcacactccagaaacacaaatcttcctcctcctttacaccttttatagaccccaga
ttactacagatttctccatctagtgggacaacagtgacttctgtggtgggattttcttgt
gatggaatgagatcggaggccataaggcaagatcctacccggaagggctcagtggtcaat
gtgaatcccaccaacactaggccacagagcgacaccccagagattcgcaaatacaagaag
aggtttaactccgagattctgtgcgctgccttgtggggagtgaacttgctggtgggtaca
gagagtggcctgatgctgctggacagaagtggccaagggaaggtgtatcctctgatcaac
agaagacgatttcaacagatggacgtcctggaaggcttgaatgtcttggtgacaatatct
ggcaaaaaggataagttacgtgtctactatttgtcctggttaagaaataaaatactccac
aacgatccagaagttgagaagaagcagggctggacgaccgtgggggacttggaaggctgc
gtgcactacaaagtcgtaaaatatgaaagaatcaagtttctggtcattgctttgaagagt
tctgtggaagtctatgcgtgggcacccaagccataccacaaatttatggcctttaagtcg
tttggagatttggtgcataagccgttactggtggatctcactgttgaggaaggccagagg
ttgaaagtgatctatggatcctgtgctggattccatgctgttgatgtggattcagggtcc
gtctatgacatttatctaccaacacacgtaagaaagaacccacactctatgatccagtgt
agcatcaaaccccacgcaatcatcatcctccccaacacggatggaatggagcttctggtg
tgctacgaagacgaaggggtctatgtgaacacctatggaaggattaccaaggatgtggtt
ctgcagtggggagagatgccaacgtctgtagcgtatattcgatccaatcagacgatgggc
tggggagaaaaggccatagagatccggtctgtggagaccggccacttggatggtgtgttt
atgcacaaaagggctcaaagactgaaattcttatgtgaacgcaatgacaaggtgttcttc
gcctcggtccggtccgggggcagcagccaggtgtacttcatgacgctgggcaggacctct
cttctgagctggtag

DBGET integrated database retrieval system