KEGG   Physeter catodon (sperm whale): 102974346Help
Entry
102974346         CDS       T06011                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04218  Cellular senescence
pcad04370  VEGF signaling pathway
pcad04625  C-type lectin receptor signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102974346 (MAPKAPK2)
   04370 VEGF signaling pathway
    102974346 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102974346 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102974346 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102974346 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102974346 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102974346 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102974346 (MAPKAPK2)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102974346 (MAPKAPK2)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   102974346 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 102974346
NCBI-ProteinID: XP_028344313
UniProt: A0A455B8K5
Position
4
AA seq 310 aa AA seqDB search
MLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDR
GDQAFTERGRKEASEIMKSIGEAIQYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGF
AKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLA
ISPGMKSRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTK
VPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKA
RALEAAALAH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgctccaggactgccccaaggcccgccgggaggtggagctgcactggcgggcctcccag
tgcccgcacattgtacgcatcgtggacgtctatgagaacctgtacgcggggaggaagtgc
ctgctgatcgtcatggagtgtttggatggtggagagctcttcagccgaatccaggaccga
ggagaccaggcgttcacagaaagaggtagaaaggaggcatcagagatcatgaagagcatc
ggcgaggcgatccagtacttgcactcaatcaacatcgcgcatcgggatgtcaagcctgag
aatctcttatacacctccaaaaggcccaacgccattctcaaactcactgattttggcttt
gccaaggaaaccaccagccacaactctctgaccactccttgttacacgccatactatgtg
gctccagaagtgctgggcccagagaagtatgacaagtcctgtgacatgtggtccttgggt
gtcatcatgtacatcctgctgtgtgggtatccccccttctattccaaccatggccttgcc
atctctccgggcatgaagagtcgcatccgaatgggccagtatgaattccccaacccagaa
tggtcagaagtatcagaggaagtgaagatgctcatccggaacctgctgaagacagagccc
acccagaggatgaccatcaccgagttcatgaaccacccctggatcatgcaatcaacgaag
gtccctcaaaccccactgcacaccagccgggtcctgaaggaggacaaggagaggtgggag
gacgtcaaggaggagatgaccagtgccttggccacgatgcgggtcgactatgagcagatc
aagataaagaagattgaagatgcgtccaaccctctgcttctgaagaggcggaagaaagct
cgggccctggaggccgcggccctggctcactga

DBGET integrated database retrieval system