KEGG   Physeter catodon (sperm whale): 102974913
Entry
102974913         CDS       T06011                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00100  Steroid biosynthesis
pcad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    102974913 (TM7SF2)
Enzymes [BR:pcad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     102974913 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 102974913
NCBI-ProteinID: XP_007119320
UniProt: A0A2Y9FC63
Position
Unknown
AA seq 462 aa
MAPQGSRAELEFGGPLGAAALMLLLPATMFHLLLVARSGPARLLGPPPYLPELEELWSPW
ALLLCLTWLGLQAALYLLPARKVAEGQELKDKSRLRYPINDVGGSTGSLHTPPPSTPSIA
TTLCTREVAGVTLRKLKCLTNGSGQGFQALVLTALLVGLGVSAGLPLSALPEMLLPLAFA
ATLTAFIFSLLLYLKALVAPASALAPGGNSGNPIYDFFLGRELNPRICSFDFKYFCELRP
GLIGWVLINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWHEEAVLTTMDIIHDGFG
FMLAFGDLAWVPFTYSLQAQFLLYHPEPLGLPLASVICLINAVGYYIFRGANSQKNTFRK
NPSDPRVADLETISTATGRRLLVSGWWGMVRHPNYLGDLIMALAWSLPCGVSHLLPYFYL
LYFTALLVHREARDEQQCLQKYGLAWHAYCRRVPYRIVPYIY
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggcccctcagggctcccgggccgagctggaattcggaggacccctgggcgctgcggca
ctgatgctgctgctgcccgccaccatgttccacctcctactggtagcccgctcgggcccg
gcgcgcctcctgggcccacccccttacctgccggaactcgaggagctgtggagcccgtgg
gcgctgttgctgtgtctcacctggctcggcctgcaggcggcgctctacctcttgccggcg
cgcaaggtggccgaggggcaggaactgaaggacaagagtcgactgcgctaccccattaac
gacgtagggggttccactggctccctccacacccctcctccctccactcccagcattgct
accactctatgcaccagagaagtggctggggtgaccctccgaaagctaaagtgtctgact
aatggctcgggacaaggcttccaggccctggtgctgacagccttgctggtgggcctgggg
gtgtcagccgggctgcccctgagcgcgctcccggaaatgctcctgcccttggcctttgcg
gccaccctcaccgccttcatcttcagcctcctcctctatctgaaggctctggtagcccct
gcctctgccctggcacccggggggaactcaggcaatcccatttacgactttttcctggga
cgggagctcaacccgcgcatctgttcctttgacttcaaatatttctgcgaactgcggcct
ggcctcatcggctgggtcctcatcaacctggccttgctgatgcaggaagcagaacttcgg
gggagtccctcgctggccatgtggctggtcaatggcttccagctactgtatgtgggtgat
gccctttggcacgaggaggcggtcctcaccaccatggacatcatacatgacgggtttggc
ttcatgctggcctttggggacctcgcctgggtacccttcacctacagcctgcaggcccag
ttcctgctgtaccacccagagcccctggggttgcccctggcctcggtcatctgcctcatc
aatgctgttggttactacatcttccgtggagccaattctcagaaaaacaccttccggaag
aatccttctgatcccagagtggctgaccttgagaccatctctacagccacaggacgacgg
ctgctggtgtctgggtggtggggtatggtccgccatcccaactacctcggagacctcatc
atggctctggcctggtccttgccctgcggggtgtcccacctgttgccctacttctacctc
ctttacttcactgcgctgttggtacaccgtgaggcccgggatgagcagcagtgtctgcag
aagtatggcctggcctggcacgcatactgccggcgtgtgccctaccgaatcgtgccctac
atctactga

DBGET integrated database retrieval system