KEGG   Physeter catodon (sperm whale): 102976054
Entry
102976054         CDS       T06011                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00230  Purine metabolism
pcad00240  Pyrimidine metabolism
pcad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102976054 (DCK)
   00240 Pyrimidine metabolism
    102976054 (DCK)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102976054 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28
Other DBs
NCBI-GeneID: 102976054
NCBI-ProteinID: XP_007112771
UniProt: A0A2Y9F1S7
Position
7
AA seq 376 aa
MRLRARGPAPPLPVTLRAGRARRGPARGGLGPRGPGRIAGLGEGGGVASPLGGRPLHSPA
SVVSCSRAPKSNPRTRRPESLQFKASSAAASAPPRTPLAASQPSLPDALGAATRRGMATP
PKRSCPSPAASSEGTPIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCNVQST
QDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAEKPVL
FFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPEK
CLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKD
KHDSLVEKVKEFLSTL
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcgcctgcgcgcgcgcggccccgcccccccgctccccgtgacccttcgtgccgggcgc
gcacgcaggggccccgcgcgaggcgggcttgggccgaggggcccgggaaggatcgcaggt
ttaggggaaggcgggggcgtggcttccccgctgggcgggcggccacttcacagtcccgcc
tccgtcgtcagctgcagccgcgcgccaaaatcaaacccgcgtacccgtcggccagagagc
ctgcagttcaaggcaagctccgcggcggcgtcggcaccgccgcgcacacccttggccgcc
tcccagccctccctgcccgacgcgctcggggccgccacaagacgaggcatggccactcca
cccaagaggagctgcccatctcccgcagccagctctgaggggacccccatcaagaaaatt
tccatcgaagggaacatcgctgctgggaaatcaacatttgtgaatatccttaaacaagtc
tgtgaggattgggaagtggttcctgaacctgttgccaggtggtgcaatgttcaaagtact
caggatgaatttgaggaactgacaacatctcagaaaagtggtgggaatgttcttcagatg
atgtatgagaaacctgaacggtggtctttcaccttccagtcatatgcctgcctcagtcga
atacgagctcagcttgccgcgctcaatggcaagctcaaagatgcggagaaacctgtatta
ttttttgaacgatctgtgtatagtgacaggtatatttttgcatctaatttgtatgaatct
gactgcatgaatgaaacagagtggaccatttatcaagactggcatgactggatgaataac
cagtttggccaaagccttgaactggatggaatcatttatcttcaagccactccagagaaa
tgcttgaatagaatatatttacggggaagaaatgaagaacaaggcattcctcttgaatac
ttagagaagcttcactataagcatgaaagctggctcctgcatagaacactaaaaaccaac
tttgattatctacaagaagtgcctatcttaacactggatgttaatgaagattttaaagac
aaacacgacagtctggttgaaaaggtaaaagaatttttgagcactttgtga

DBGET integrated database retrieval system