KEGG   Physeter catodon (sperm whale): 102976556Help
Entry
102976556         CDS       T06011                                 

Gene name
DDX18
Definition
(RefSeq) ATP-dependent RNA helicase DDX18
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pcad03041]
    102976556 (DDX18)
   03009 Ribosome biogenesis [BR:pcad03009]
    102976556 (DDX18)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     102976556 (DDX18)
Spliceosome [BR:pcad03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    102976556 (DDX18)
Ribosome biogenesis [BR:pcad03009]
 Eukaryotic type
  90S particles
   Helicases
    102976556 (DDX18)
  Pre-60S particles
    102976556 (DDX18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII FAM60A
Motif
Other DBs
NCBI-GeneID: 102976556
NCBI-ProteinID: XP_023970783
UniProt: A0A2Y9RWU0
Position
2
AA seq 700 aa AA seqDB search
MFHLPMKLLRKKIEKRNLRLRQRNLKLQGASAVNLSETQNGDVSEGTVGGGKIKKPLKQS
VNVGLSETQNGDISEEVVVGGKVKKFLKQSMNAGWSEAQNGDLPKETVENVKVKKSSKKS
TTLTSGEAAMQSPNAESKKKKKKKKRKIVDDAGPDSKKAKTEDQGDSEDGAQAPEETENS
VEKPDNEDDDSMVPSLPLGLTGAFEDTSFDSLTNLVNENTLKAIKEMGFTNMTEIQHKSI
RPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLKFMPRNGTGVLILSPTRELAMQTFGV
LKELMTHHVHTYGLIMGGSNRSAEAQKLANGINVIVATPGRLLDHMQNTPGFMYKNLQCL
VIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYVGVDD
DKAHATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCKSVKYHYELLNYIDL
PVLAIHGRQKQNKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQYDPPDDPKEYI
HRVGRTARGLNGRGHALLILRPEELGFLRYLKQSKVPLSEFEFSWSKISDIQSQLEKLIE
KNYFLHKSAQEAYKSYIRAYDSHSLKQIYNVNNLNLPQVALSFGFKVPPFVDLNVNSNDG
KLRKRGGGGGFGYQKARKVEKSKIFKHISKKPSDGRQFSH
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatctaccgatgaaacttttacgcaagaagatcgagaagcggaacctcagattg
cgacagcgaaacctaaagctccagggggcctcagctgtgaacttgtcagaaactcaaaat
ggagatgtgtctgaaggaacagtgggaggtggaaaaattaaaaagcccctaaaacagtct
gtgaatgtgggcttgtcagaaacccaaaatggagacatctctgaagaagtagtagtaggt
ggaaaagttaaaaaattcctaaaacagtctatgaatgcaggctggtcagaagcccaaaat
ggagacttacctaaagaaacagtggaaaatgtaaaagttaaaaaatcctccaagaaatct
accacactgaccagtggggaagcagcaatgcagtctcccaatgcagaatcaaaaaagaag
aagaagaagaaaaagagaaaaatagtggatgatgctgggcctgattccaaaaaagcgaaa
actgaagaccaaggagactctgaagatggtgcccaggctcctgaagaaacagaaaacagt
gtggagaagccagacaatgaggacgatgacagcatggtgcccagcctgcccctgggactg
acaggagcttttgaggatacttcgtttgattctctgactaatcttgtcaatgagaacact
ctgaaggcaataaaagaaatgggctttacaaacatgactgaaattcagcataaaagtatc
agaccacttctggagggcagggatcttctagcagctgcaaaaacaggcagtggcaaaacc
ctggcatttctcattcctgcagttgaactcattgttaagttaaagttcatgcccaggaat
ggaacaggagtccttattctctcacctactagggaactagccatgcagacttttggcgtc
cttaaggagctgatgacacaccatgttcacacatatgggttaataatgggtggcagtaac
aggtctgctgaagcacagaagcttgccaatgggatcaacgtcattgtggccacaccaggc
cgcctcctggaccatatgcagaataccccagggtttatgtataaaaacctacagtgtctg
gttattgatgaggctgatcgtatcttggatgttgggtttgaagaagaattaaagcaaatt
attaaacttctgccaacccgcagacagaccatgctcttttctgccacacaaactcgaaaa
gttgaagacctggcaaggatttctctgaaaaaggagcccttgtatgttggtgttgatgac
gataaagctcatgcaaccgtggacggtcttgagcagggatatgttgtctgtccttccgaa
aagagattcctcctactctttacattccttaagaagaaccggaagaagaaactgatggtt
ttcttttcatcctgtaagtccgtgaaataccactatgagttgctgaactacatcgatttg
cctgtcttggccattcatggaaggcagaaacaaaataagcgtacgaccacgttcttccag
ttctgcaatgcagattcggggatcttgttgtgtacagacgtggcagctagagggctggat
attcctgaagtggactggattgttcagtatgaccctccggatgaccccaaggaatatatt
catcgtgtgggtagaacagccagaggcctgaacggcagagggcatgccttgctcattttg
cgccctgaagaattgggtttccttcgctacttgaagcagtccaaggttccgttaagtgaa
tttgagttttcctggtccaaaatttctgacattcagtctcagcttgaaaagctgattgaa
aagaactacttccttcataaatcagcccaggaagcgtataagtcatacattcgagcgtat
gattcccattcgctgaaacagatctataatgttaataacttaaacttgcctcaggttgct
ctgtcatttggtttcaaggtgcctccttttgttgatttgaacgtgaacagcaacgacggc
aaacttagaaaaaggggcggcggcggtggcttcggctaccagaaagccagaaaagtcgag
aagtccaagatcttcaagcacataagcaagaaaccatctgacggcaggcagttctctcac
tga

DBGET integrated database retrieval system