KEGG   Physeter catodon (sperm whale): 102977680
Entry
102977680         CDS       T06011                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X3
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pcad01002]
    102977680 (ERAP1)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102977680 (ERAP1)
Peptidases and inhibitors [BR:pcad01002]
 Metallo peptidases
  Family M1
   102977680 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102977680
NCBI-ProteinID: XP_007121239
UniProt: A0A2Y9FEW8
Position
8
AA seq 940 aa
MISLSIKRPLVTMSFLLSSLLMLLTAATPSWCQSSETTSPKASNRAPFPWNKMRLPEHII
PVHYDLMIHVNLTTLTFGGTTEIEITASKPTSTIILHSHHLQIPKAALRKGAGEKQSEEP
LRVLEYPPQEQIALLAPEPLVVGLPYTIVIDYAGNLSESFHGFYKSTYRTKEGEVRILAS
TQFEPTAARMAFPCFDEPAFKASFSIKIRREPRHIAISNMPLVKSVTVAEGLVEDHFDVT
VKMSTYLVAFIVSDFKSVSKITKSGIKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLSKQDLAAIPDFQSGAMENWGLTTYRESSLLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFDKCFNAMEVDALNSTHPV
STPVENPAQIKEIFDEVSYEKGACILNMLRDYLGADAFKSGIVKYLQKYSYKNTKNEDLW
NSMASICPTDGTQRMDGFCSRGEHSSSHWRQEGLDVKTMMNTWTLQKGFPLVTITVRGRN
VHMKQEHFVKGPDDAPETGYLWHVPLTFITSNSDSVQRFLLKTRTDVLILPEEVEWIKFN
VGMSGYYIVHYEDDGWASLTGLLKGTHRAISSSDRASLINNAFQLVSIGKLSIEKALDLT
LYLKHETEVMPVFQGLNELIPMYRLMEKRDMNEVETQFKAFLIGLLRDLIDKQTWTDEGS
ISERMLRSHLLLLACVHKYQPCVQKAEGYFRQWQEANGNLSLPSDVTLAVFAVGAQNPEG
WDFLYSKYQSSLSSTEKNQIEFALCIIHNKEKLQWLLDQSFKGDTIKTQEFPDILRAISR
NPVGYPLAWQFLRENWNKLVQKFELGSSSIAYMVMGTTNQFSTRAWLEEVKEFFSSLKEN
GSQLRCVQQTIETIEENIRWMDKNFDKIRVWLQNEKLELL
NT seq 2823 nt   +upstreamnt  +downstreamnt
atgatatctctgtccatcaaacggccccttgtgaccatgtcctttctgctttcatcactg
ttgatgctcttaactgcggcaactccatcctggtgtcagagcagtgaaacgacatctcca
aaggctagtaacagggcaccatttccttggaataaaatgcgacttcccgagcacatcatc
ccagttcattatgatctcatgattcatgtcaacctcaccactctgactttcggaggaacc
acggaaatagaaatcacagccagcaagcccaccagtaccatcatcctgcatagtcaccac
ctgcaaatacctaaggccgccctgaggaagggagctggtgagaagcagtctgaagagccg
ctgagagtcctggaatacccgcctcaggagcagatcgcactcctggctcctgagcccctg
gtggttgggctcccatacaccattgtcattgactatgctggcaatctttctgagagtttc
catggattttataaaagcacctacagaaccaaggaaggggaagtgaggatacttgcatca
acacagtttgaaccgactgcagccagaatggcctttccctgctttgatgaacctgctttc
aaagcgagtttttcaatcaagatcagaagggaaccaagacacatcgccatctccaacatg
ccactggttaaatctgtgactgttgctgaaggactcgtagaagaccactttgatgtgact
gtgaagatgagcacctacctggtggccttcattgtttcagattttaagtctgtcagcaag
ataaccaaaagtggcatcaaggtttccgtgtatgctgttccagacaagataaatcaggca
gattatgccctggatgccgcagtgactcttctagaattttatgaggattatttcagcatt
ccatatcccttatccaaacaagatcttgctgctattcctgactttcagtctggtgctatg
gaaaactggggactgacaacatacagggaatcttctctactgtttgatgctgaaaagtct
tcagcatcaagtaagcttggcatcacgatgaccgtgtcccatgaactcgcccaccagtgg
tttgggaacctcgtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagttcgtgtctgtcagtgtgactcatccagaactgaaagttgaagattat
ttctttgataagtgttttaatgctatggaggtagatgcgttaaactccacacaccctgtg
tccacacctgtcgagaatcctgctcagattaaggagatatttgatgaagtttcttatgaa
aagggagcttgtattctgaatatgctaagggattatcttggtgccgatgcatttaaaagt
ggtattgtaaagtatctgcagaagtatagctataaaaacactaaaaacgaggacctctgg
aatagtatggcaagtatttgccctacagatggcacacaacgaatggatggattttgttct
agaggtgaacattcatcttcacactggcgacaggaaggcctcgatgtgaaaaccatgatg
aacacctggacgcttcagaagggctttcccctggtaaccatcacagtgagagggaggaac
gtacacatgaagcaagagcacttcgtgaaaggcccggacgacgccccagaaactgggtac
ctgtggcatgtcccgttgacattcattaccagcaactcagactcagtccagcgatttttg
ctgaagacaagaacagatgtgctcatcctcccagaagaggtggaatggatcaaatttaat
gttggaatgagtggctattacatagtgcattatgaggatgatggatgggcttctttgact
gggcttttaaaaggaacacacagggcaatcagcagcagtgatcgggccagtctcattaac
aatgcttttcagcttgtcagcattggaaagctatccattgaaaaagccttggatttaacc
ttgtacttgaaacatgaaactgaagtcatgccagtgttccaaggtttgaatgaactgata
cctatgtataggttaatggagaaaagagatatgaatgaagtggaaactcagttcaaggcc
tttctcatcgggctgctgagggacctcattgataagcagacttggacggatgagggctcc
atctcagagcgaatgctgcggagtcatctgcttctcctggcctgtgtgcacaagtaccag
ccctgtgtgcagaaggcagaaggctatttcagacagtggcaggaagccaatgggaatttg
agcctgcccagcgatgtgaccttggcagtgtttgctgtaggggcccagaacccagaagga
tgggattttctttacagtaaatatcaatcgtcattgtccagtactgagaaaaaccaaatt
gaatttgctctctgtattatccacaataaagaaaagcttcagtggctgctagatcaaagt
tttaagggagatacaataaaaactcaagagtttccagatattcttagagctatcagcaga
aacccagtgggatatccattggcctggcagtttctgagggaaaattggaataaacttgta
caaaagtttgaacttggctcaagttccatagcctacatggtaatgggaacaacaaatcaa
ttctcgacaagagcatggcttgaagaggtaaaagaattcttcagctctttgaaggaaaat
gggtctcagctccgttgtgtccagcaaacaattgaaaccattgaggaaaacatacgttgg
atggataagaattttgataaaatcagagtgtggctacaaaatgaaaagcttgaactgctg
taa

DBGET integrated database retrieval system