KEGG   Physeter catodon (sperm whale): 102978114Help
Entry
102978114         CDS       T06011                                 

Gene name
FKBP3
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP3
  KO
K09570  FK506-binding protein 3 [EC:5.2.1.8]
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pcad03110]
    102978114 (FKBP3)
Enzymes [BR:pcad01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102978114 (FKBP3)
Chaperones and folding catalysts [BR:pcad03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    102978114 (FKBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTHB FKBP_C
Motif
Other DBs
NCBI-GeneID: 102978114
NCBI-ProteinID: XP_023989394
UniProt: A0A2Y9TKA9
Position
11
AA seq 224 aa AA seqDB search
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFESKRFKGTESISKVSEQVKNVKLNEDKPRETKSEETLDEGPPKYTKSVLKKGD
KTNFPKKGDIVHCWYTGTLQDGTVFDTNIQTSSKKKKNAKPLSFKVGIGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgttccacagcgggcctggaccgtggagcagctgcgcagcgagcagctg
cctaagaaggacattatcaagtttctgcaggatcacggttcagattcgtttcttgcagaa
cataagttattaggaaacattaaaaatgtggccaagacagctaacaaggaccatttggtt
acagcctataaccatctttttgaaagtaagcgtttcaagggtactgaaagtataagcaaa
gtgtctgagcaagtgaaaaatgtgaagcttaatgaagataaacccagagaaaccaagtct
gaagagactctggatgagggtccaccaaaatatacaaaatctgttcttaaaaaaggagat
aaaaccaactttcccaaaaagggagatattgttcactgctggtatacaggaacactacag
gatgggactgtttttgatactaatattcaaacgagttcgaagaagaagaaaaatgccaag
cctttaagttttaaggttgggataggcaaagttatcagaggatgggatgaagcactcttg
actatgagtaaaggagaaaaggctcgactggagattgaaccagaatgggcttatggaaag
aaaggacagcctgatgccaaaattccaccaaatgcaaaacttatttttgaagtggaatta
gtggatattgactga

DBGET integrated database retrieval system