KEGG   Physeter catodon (sperm whale): 102978588Help
Entry
102978588         CDS       T06011                                 

Gene name
TTN
Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad05410  Hypertrophic cardiomyopathy (HCM)
pcad05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    102978588 (TTN)
   05414 Dilated cardiomyopathy (DCM)
    102978588 (TTN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102978588 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102978588 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcad04812]
    102978588 (TTN)
   04147 Exosome [BR:pcad04147]
    102978588 (TTN)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102978588 (TTN)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   102978588 (TTN)
Membrane trafficking [BR:pcad04131]
 Others
  Actin-binding proteins
   Others
    102978588 (TTN)
Cytoskeleton proteins [BR:pcad04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     102978588 (TTN)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102978588 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Ig_6 Pkinase Titin_Z fn3_4 PPAK C1-set Ig_5 Pkinase_Tyr SusE THB Ig_4
Motif
Other DBs
NCBI-GeneID: 102978588
NCBI-ProteinID: XP_028335408
UniProt: A0A455AHY9
Position
2
AA seq 35134 aa AA seqDB search
MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD
GRARLMIPAVTKANSGRYSLRATNGSGQATSTAELLVTAETAPPNFVQRLQSMTVRQGSQ
VRLQVRVTGIPTPVVKFYRDGAEIHSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
SVGRATSTAELLVQGEEVVPAKKTKTIVSTAQISETRQTQIEKKIEAHFDARSIATVEMV
IDGATGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
PSPVRSVSPAGRISTSPIRSIKSPLLVRKAQMPTMPPGPEVPPPWKQEGYMASSESEMRE
TMVTSATQIRTEERWEGRYGIQEQVTISGAAGAAASATFAAGAAAAAAAEVKQEADKSAA
VATVVAAVDMARVREPVISAVEQTAQRTTTTAVRIQPAQEQIKKEAEKTAVTKVVVAADK
AKEQELKARTREVITTEQEQVHITHEQIRKETEKAFVPKVVISAAKAKERETRITGEITT
KQEQKQITQETIMKETRKTVVPKVIVPMPKVKEQDLVSRTREDITAKREQVQITQEKMRK
EAEKTALSAIAVATAKAKEQETILRTREEMAARQEQIQVTHGKVGVEEKAEAVATVVAAV
DQARVREPREPGHVEEMYAQKTTLEYEFKEHVSAAKVAEHPPRPASEPHIVPKAVKPGVI
HAPSETHITTTDQMGIHISSQIKKTTDLTSERLVHVDKRPRTASPHFTVSKISVPKPEHG
YEASIAGSAIATLQKEFSATPSAQKVTKSVKAPTVKPAEARVRAEPTPSPQVPFVDTPET
FKSQADIEVEKEVGVSIAGGAVREEHFEVLHEREAKVTETARIPAPVEIPVTPPTLVSGL
KNVTVIEGESVTFECHISGYPSPKVTWYREDYQIESSIDFQITFQSGIARLMIREAFAED
SGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETAVAEKITTEEKRFVEARDVIMTDTSIT
EEPAGPGEPAAPFFITKPVVQKLVEGGSIVFECQVDGNPKPHVYWKKSGVPLTTGYRYKV
SYNKQTGECKLVISMMFADDAGEYTIVIRNKHGETSASASLLEEADYESLMKSQQEMLYQ
TQMTAFVQEPKVGEIAPGYVYSEYEKEYEKEQALIRKKMAKDTVMVRTFVEDQEFHISSF
EERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVEAGFDLRVKNYRIFEGMGVTF
HCKMSGYPLPKIAWYKDGKRIRHGERYHMDFLQDGRASLRIPVVLPEDEGIYTAFASNIK
GNAICSGKLYVEPAAPLSAPTYIPTPEPVSRIRSISPRSVSRSPIRMSPARMSPLRMSPA
RMSPGRRLEETDESQLERLYKPVFVLKPTSFKCLEGQTARFDLKVVGRPMPETFWFHDGQ
KIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGKSSISVILTVEAVEHQVK
PVFVEKLKNLNIKEGSRLEMKVRATGNPNPDIIWLKNSEIIVPHKYPKIRIEGTKGEAAL
KIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAP
ELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMV
VEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVK
DEKSLVEESQLPEGRKGLQRIEELERMAHEGALTSVTTDQKEKQKPDIVLFPEPARVLEG
ETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAE
NPEGVIEHKVKLEIQQREDFRSVLRRAPEPKPEFHVHEPGKLQFEVQKVDRPSDTTETKE
VVRLKRTERITHEKVSEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTK
DELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGHGSDV
HFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAIN
IAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGVEVH
TGDKYRMLSDRKVHFLSVLTVDTSDAEDYSCVLVEDENVKTTAKLIVEGAVIEFVKELQD
IEVPESFSGELECIITPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGE
YSFVVDGKKTTCKLKMKPHPVAILQGLSDQKVCEGDIVQLEVKVSLENVEGVWMKDGEEV
QPGDRVHIVIDKQSHMLLIEDMTKEDAGHYSFTIPALGLSTSGRVSVYSVDVITPLKDIN
VLEGTKAVLECKISVPDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVINRTYASDEGPY
KLMVGRVETSCDLSVEKIKIIRGLHDLTCTETQNVVLEVELSHSGIDVLWNFKDKEIKPS
SKYKIEAREKIYKLTVLNMMKDDEGEYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQ
EAVFECEVANPDSEGEWLKDGKHLPLSKNIRSKSDGHKRRLIIAATKLDDIGEYTYKVAT
SKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIRNGVVLESNDKYTV
SVKGTIYSLRIKNCAVVDESVYGFKLGRLGASARLHVETVKIIKKPKDVTALENATIAFE
VSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQHISPLDSGEYTAVVGQLECKA
KLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKL
HQLIIMNTSTEDSAEYTFVCGNDQVSATLKVTPIMITSMLKDINAEEKDTITFEVTVNYE
GISYKWLKNGVEIKSTDRCQMRTKKLTHSLNIRNVHFGDAAEYTFVAGKATSTATLYVEA
RHIEFRKHIKDIKVLEKRRAMFECEVSEPDITVQWMKDGQELQLVDRVKIQKEKYVHRLL
IPSTRMSDAGKYTVVAGGNMSTASLFVEGRDVRIRSIKREVQVIEKQRAVVEFEVNEDDV
DAHWYKDGIEINFQVQERHQYVVERRIHRMFISETRHSDAGEYTFVAGRNRSSVTLYVNA
PEPPQILQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYT
LLLIEAFPEDAAVYTCEAKNDYGIVTTSASLSVEVPEVVSPDQEMPVYPPAIVTPLQDTV
TSEGRPAHFQCRVSGTDLKVSWYSKDKKIKPSRFFKMTQFEDTYQLEIAEAFPEDEGIYT
FVASNAVGQVSSTATLRLEAPESMLHEQIEMEMKELASLLSAEEEGPQTSSSGLQLSNRN
ETVELLSEPPVHSTKFDSKEEGSVPVFIKEVSNADISIGDVAKLSVTVIGIPKPQIQWFF
NGVMLTPSADYKFVFDSNDYSLIILFTKLEDEGEYTCIASNEYGQAICSAYLKINSKGEG
LQEPESAEEKSLEKLEGPCPPYFLKELKAVHCAQGLPAIFEYTVLGEPAPTVLWFKENKQ
LCTNVYYTIIHNPDGSGTFIVNDPQKEDSGFYVCKAENVWGESTCAAELLVFLEDTHKTD
APCKATSTPEAPEDFPQTSLTVPAVEALDSEQETSAFVKDTILKAALIAEGKQQLSYEHI
VKTNELSSQVTLIAEQLQSTLMLEQDMPTPESIGERLSISDTIHVQPIKEPPPNVELQIV
QSQDTVSKEDILMYQEAELQVVLSDTEKIFPSAMSIEEISSLRVESLQTFLAEPEGSYPQ
SSIEETPAHSYPTSVAEEVLLPKEKIVSAVGEEQRVILQKQEVQSALILNQSLAEGHVES
SQGPDIMISRVPSEHTCTEGEILMESVDQLDSAKQDFAASVEEGKSLRFPLAGEEKQVLL
KEERSDSLAMPPNQTTEYKKEPMAISGVQEVQGSDLLSKESLLSGIPEEQRLNLKTQIRR
AWQAAVASEQLSLFSEWLRNIAQVEVKAIDFSREPNCIMCTYFITSVKSLTEELTITIEG
IDPQMTNLKTELKEALCSIICEEMNILTAEKPGIQKGATIDLQEEMDSFSNPQKVEAITE
PEVESKYLVLKEEISYFKVKSQVKAVGATAASAAVSDEKLDEIPKPSEEKEKSSEGGTEK
SGTVEIREAEGSSLREGGPDVQTPLVDTIAKEGDTVSLASSITNAKQVNWYFESKLVPSD
EKFRSLQDKNTYMLVIDKVNREEHQGEYMCETLNDDRKAATSAKLTVVKRAAPVIRRRIE
PLEVALGHLAKFTCEIHSAPNVRFQWFKAGREIYESDKCSIRSANYVSTLEILRTQVVDC
GEYTCKASNEYGSISCTAALTVTEAYPPAFLSRPKSITTFVGKAAKFLCTVTGTPVIETI
WQKDGVALSPSPNCRISDANNKHILELSNLTIQERGVYSCKASNKFGADTCQAELVIIDK
PHFIKELEPVQSAVNKRVHLECQVDEDRKVTVTWSKNGQKLPPGKDYKICFEDKIASLEI
PLAKLKDTGTYVCTASNEAGSSSSSATVTIREPPSFVKKVDPSYLMLPGESARLHCKLKG
SPVIQVTWFKNNKELTESNTIRMSFVNSEAVLDITDVKVEDSGNYSCEAVNDVGSDSCSA
EIVIKEPPSFIKTLEPADIVRGTNALLQCEISGTGPFEIRWFKDKKQIRSSKKYRLFSQK
SVVSLEVFSFNRADVGEYECVVANEVGKCGCLATHLLKEPPIFVKKVDDFTALAGQTATL
QAAVKGSEPISVTWMKGQKIIKEDGKIKMSFVNGVAVLIIPDVQISFADKYTCLAENEAG
SQTSVGELIVKEPAKIVERAELIQVTAGDPATLEYTVTGTPELKPKWYKDGRPLIASKKY
RISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVD
SVVSGTCRLDCKIAGSLPMRVSWFKDGKEIASSDRYRIAFVEGTASLEISRIDMNDAGNF
TCRATNSMGSKDCSGALIVQEPPSFVTKPASKDVLPGSTICLKSTFQGSTPLTIRWFKGD
KELVSGGNCYITKEALESSLELYVVKTSDSGTYTCKVSNVAGAVECSAKLFVKEPATFVE
KLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHKISFVESTAVLTLKDVA
VDDSGEYMCEAQNEAGSDHCGSILIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFE
ITWFKDNTTLRSGRKYKTFIQDQLVSLQILRFVAADVGEYQCRVTNEVGSSSCSAKVTLR
EPPAFVKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDNDEITEDDNIRMTFENNVASL
YLSGIEIKHDGKYVCQAKNDAGVQRCSALLSVKEPATIIEEAVSIDVTQRDPATLQVKFS
GTKEITAKWFKDGQELTLGQKYKISVTDTVSILKIISTEKRDSGEYTFEVQNDVGRSSCK
ARINVLDLIIPPSFAKKLKKMDSIKGSSIDLECIVAGSHPMSIQWFKDDQEITASEKYKF
SFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFLEKPQSQDVNPNT
RVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTILELFSAKAADLGTYICQLS
NDVGTATSKATLFVKEPPHFIKKPSPVLVLRNGQSTTFECQITGTPEITVSWYLDGNEIT
AIEKHGISFTDGLATFQISGARVEHSGTYVCEARNDAGTASCSIELKVKEPPTVIRELKP
MEVVKDSDVELECEVMGTSPFEVTWLKNNKEIRSSKKYTLTDRVSVFNLNINKCDPSDTG
EYQCIISNEGGSCSCSARVSLKEPPLFTKKIENVTTVLKSSATFQSTVTGSPPIFITWLK
DDQILDEDDNVHISFVNNVATVQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQI
LEKPKSVDVTEKDPVTLECLVAGTPELTVKWFKDGKQMVPSRYCSMSFENNVASFRIQSV
MKQDSGTYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLSKMDKVLGSSIHMECKVSGS
LPISAQWFKDGKEITTSAKYRLVCHENTVSLDVSNLELEDTANYTCKVSNVAGGEACSGI
LTVKEPPSFLVKPERQQAIPDSTVEFKAILKGTPPFKVKWFKDDVELASGPKYFIGLEGS
TTFLNLYSVDASKTGQYTCQVTNDVGSDSCTTVLLVTEPPKFAKKLEATKIVKAGDSARL
ECKITGSPDIRVVWYRNEHELPASDKYRMAFIDSVAVIQMNSLGTEDSGDFICEAQNPAG
STSCSTKVIVKEPPVFSSFPPVVETLKNAEVSLECELLGTPPFQVVWYKDKRQLRSSKKY
KIASKNFHASIHILSVNTSDIGEYHCKAQNEVGSDTCICTVKLKEPPRFVSKLNSLTVVA
GEPAELQASIEGTQPISVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYIC
QIRNDGGMRENMATLTVLEPAVIVEKAGSMTVTAGETCTLECKVAGTPELSVEWYKDGKL
LTSSQKHKFSFYNKISSLKILSVEKQDAGTYTFQVQNNVGKSSCTAVLDVSDRMVPPSFT
RRLKDTVGVLDTSCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCALQLNSLD
SSDMGNYTCIAANVAGSDECRAVLAVQEPPSFVKEPEPLEVLPGKNITFTSVIRGTPPFK
VGWFRGARELVKGDRCNIYFEDTVAELELFNVDISQSGEYTCVVSNNAGQTSCTTRLFVK
EPAVFVKKLSGHSVEPGKSIILESTYTGTLPISVTWKKAGVNITPSEKCNIVTTEKTCIL
EILNSTKGDAGQYSCEIENEAGKDVCEALVSTLEPPYFVTELKPLEASVGDSVSLQCQVA
GTPEVTVSWYKGDTKLRSTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSK
TVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQT
SFVDNVATLKILQTDLSHSGQYSCSASNSLGTASSSARLTAREPKKSPFFDIKPVSIDVI
AGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTC
QATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIKLECKISGSPEIKVLWFRNDG
ELHESWKYNMSFVDSVASLTINEASTEDSGDYICEAHNGVGDASCSTALTIKAPPVFTQK
PSPVGALKGSDVIFQCEISGTPPFEVVWVKDRKQVRSSKKFKITSKNFDTSLHILNLEAA
DVGEYHCKAANEVGSDTCVCTVKFKEPPRFVKKLSDTSTLAGDAVELQAVVEGFQPIAVI
WLKDKGDIIRESENTRISFIDNVATLQLGSPEASNSGKYVCQIRNDAGMRECSAVLTVLE
PARIIEKPEPMTVTTGNPFALECAVAGTPELSAKWFKDGRELSADSKHHITFINKVASLK
IPCAEMSDKGLYSFEVKNSVGKSNCTVSVHISDRVVPPSFIRKLKHTNAVLGASAVLECR
VSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSFLEPSDTGTYTCVAANVAGSDE
CSAVLTVQEPPSFEQTPDSLEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVSGESCSIS
LEDFVTELELFEVEPLQSGDYSCLVANDAGSASCTTHLFVKEPATFVKRLADFSVETGNP
IVLEATFTGTPPISVSWMKNEFPLTQSRNCSITMTEKSTILEILDSTIEDYAQYSCLIEN
EAGQDICEALVSVLEPPYFIEPLEHMEVAVGEPVTLQCKVDGTPEIRISWYKEHTKLRSA
PAYKMQFRNNVASLVINKVDPSDMGEYTCKAENSVGAVASSAVLVIKERKLPPSFARKLK
DVQETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHV
GQYNCSASNPLGTASSSAKLILLDHEIPPFFDLKPVSVDLALGESGSFKCHITGTAPIKI
TWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNVAGKDSCSAHLGVQE
PPRFIKKLEPSRIMKQDESTRYECKVGGSPEIKVLWYKDETEIQESSKFRMSFLDSVVVL
EIHSLSVEDSGDYTCEARNAAGRASSSTSLKVKEPPVFRKKPHPVETLEGADVHLECELQ
GTPPFQVSWHKDKRELRSGKKYKIMSENFLTSIHILSVSAADVGEYHCKATNDVGGDTCV
GSITLKAPPRFVKKPSDISTIVGEEVQLQAAIEGTEPISVVWFKDKGEMVRESDNIWISY
SENIATLRFSRAETANAGKYTCQIKNDAGMQECFATVSILEPAAIVEKPESIKVTTGDTC
TLECMVTGTPELTTKWFKDAKELTSDSKYKISFFNKLSGLKIINVAPSDSGVYSFEVQNP
VGKDSCTASVHVSDRTIPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNQIS
SGRKYQTTLTDNTCALTVNMLEESDAGDYTCIATNVAGSDECSAPLTVREPPSFVQKPDP
VDVLTGTNVTFTSLVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSG
EYTCIVSNEAGKASCTTHLYVKAPAKFVKKLNDYSLEKGKSLILEGTYTGTLPISVTWKK
NGINITPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYF
VKQLEPVRVTIGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQV
DSNDSGEYICRAENSVGEVSSSTFLTVQEEKLPPSFSRQLRDVQETVGLPVVFECAVSGS
EPILVSWFKDGKPLKDGPNVQTSFLDNVATLNIFQTDRSFAGQYSCTATNPIGSASSSAR
LILTEGKNPPFFDIPLAPVDAVVGDSADFECHVTGTQPIKFTWAKDNREIQSGGNYQISY
LENSAHLTILKVHKGDSGQYTCYAVNEVGEDSCMAQLNIKERLIPPSFTKKLSETVEETE
RSSFKLEGLVAGSQPISVAWYKNNVEIHPTSNCEITFKNNTLLLQVKKAGMDDAGLYTCK
VSNDAGSALCTSSVVIKAPKKPPVFDQHPTPVTVSEGEFVQLSCHVQGSEPIRIQWLKAG
REIKPSDRCNFSFANGTAVLELKDVAKADAGDYVCKASNVAGSDTCKSKVTVKDKPAAIP
AAKKAAVDGKLFFISEPQSMRVVEKTTATFIAKVGGDPVPDVKWTKGKWRQLNQGGRIFI
HQKGDEAKLEIRGTTKTDSGLYRCVAFNKHGEIESNVNLQVDERKQQEKIEGDLRAMLKK
TPALKKGAGEEEEIDIMELLKNIDPKEYEKYARMYGITDFRGLLQAFEMLKQSQVEETHR
LEIEEIEKSEKEEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINY
PEIKLSWYKGTEKLEPSDKFEISIDGDQHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVI
EPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSDWFRNGRILKPQGRYKTEVEHKVHKLTI
ADVRAEDQGQYTCKYEDLETSAELGIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAI
VTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYL
TTKEIKLEMKPPDIPDSRVPIPTMPIRAVPPEEIPPTAVPPIPLLLPSPEEKKPPAKRIE
VTKKAVKKDAKKVVTKPKEEAPPPKVPEVAKKPPPPTVLIPAEAPEMIDVSSKAEEVKIM
TITRKKEVQKEKEAVYEKKQAVYEEEKVYIESLEEPYDELEVEPYTEPYEEPYYEEPDED
YEETQVEAKREVHEEWEEDFEEGQEYYEREEGYEEGEEEWEETYQEREVIQVQKEAYEES
RERKIPAKVPEKKEVPPPKVVKKPVVEKIEKTSRRMEEVQVTKVPEVSKKIVPQKPSRTP
VQEEVIEVKVPAVHTKKMVISEEKMFFASHTEEEEVSVTVPEVQKKTVTEEKIHVAVSKK
IEPPPKVPEPPKKPVSEEVVPVPHLPKKVEPLPAKVPEVPKKPVPEEKKPVPVPKKEPAA
PPKVPEVPGRPVPEEKIPVPVAKKKEAPPAKVPEVQKRVVTEEKITIVTEREESPPPAVP
EILKEKVPEEKRPVPRKEEEVPPPKVPALPKKPVPEEKVPVPVPAAKKAPPPRAEVSKET
VVEEKRFVGEEKLSVAVPQRVEVVQHEVSAEEEWSYSEEEERVYVSVYREEEREEEEEEV
ELTEYEVMEEPEEYVVEEELHFISEKVDVEPAKVPEKKIVPKPKTPAKIEEPPPAKVPEV
PKKIVPEKKIPAAVPKKEKVPPAKVPEEPKKPVPEKRAPPKVAKIEEPPPLKVTERHMQI
AQEEKVHFAVTKKVEPPRPRVPEEPKRAAPEEKVPKLKPRKEEEPPVKVTELRKRAVQEQ
KVSIEVPKREPPAGKEVTVTAEKEWAYTQEEETVSVQWEEEYEEYDYKEFEEYEPTEEYD
QYEEYEEHEFEHYEEYKEHEEYVTEPEKPIPVKPVQEEPVLTKPKIPPAKVPKKMVPEEK
VPVPIPKKLKPPPPKVPEEAKKVVEEKIHISITKREKEQVTEPADKVPMKPKRVVTEEKV
PVPKKEVAAPVRVPEVPKRQPEEIAFEEEAVTQVEEYFEEEYIHEKEELITEEEEELKTE
EVVPVVPIKVPEVPKKPVPEEKPVPVPKKKEAPPAKVPEIPKKPEEKVPVPIPKKEKAPP
AKVPEVPKKPVPEEKVPVPVPKKVEAPPAKVPEVPEKPVPEKKVLVPAPKKVEAPSAKVP
VVPKKVITEEKEPTPVPKKVEAPSPKVPKKREPVPVPVPVPVALLREEKVVFEEEIVLEE
EVLPEEEEVPPAEEEIPPEEEEIPPEEEEVPPEEEEILSEEEEVAPEEEEIPFGEEEFVP
EEEVVPEEEVLPEIKPKVPVPARVPEVPKKPVPEKKVPVPAPKKVEPPPPKVPEVKKKVP
EKKVITPKKEEAPPATVPEVSKKAEERRIIVPKEEEVPPVEVFEEPEEPIPEEEIPEEPP
CIEEVEEVAPPRVPEVVKKAVPEAPTPVPKKVEAPPAKVPKKVPEEKVPVPVQKKEAPPA
KVPEVQKKVPEKKVPEKKVPEKKVPEKKVPVPKREAVPPAKGRAVLEEKISVAVHKEEVV
KERAELEIVEAQVEEAHEEEFHEVEEYFEEEFHEVEEVLKVEEYRAEEEVHEVEKVHRVI
EVLEAEEVEVYEKPKAPPKGPEISEEIIPPKKPPTKVVPRKEPPAKVPEVPKKIVVEEKV
HVPEEPEVPPAKAPEVPKKIVPEEKVREAVPKKPEVPPAKVPEAAQEGVPAKRVPSKKRE
PPSVKVPEAPQEIFPEKKTYVVRHEKTEALPDEVPEVPEEVVWEKKVHPPQKPEVLSVKV
PEAPKEVFPEKKVPVAPPKKREVPPVTVPEAPKEFAPEKKAPVAPPKKPEVPPVTVPEAP
KEVVPEKKVPVMPPKKPEVPPVTVPEAPKEVVPEKKVPVMPPKKPEVPPAKVPEVPKAAV
PEKKVPEAIPPKPESPPPAVPEVPPKEAIPEKKVPVAPPKKPEALPAKVPEVPKEVVHEK
KVAVPKKPEVPTAKVPKAAQEVAPEKKVPKAPPKKPEAPPVTVPEVPEEVVPEKKVPKAP
PKKPEAPPVTVPEVPEEVVPEKKVPKAPPKTPEAPPVTVPEVPEEVVPEKKVPKAPPKKP
EAPPVTVPEVPEEVVPEKKVPKAPPKTPEAPPVTVPEVPKEVVPEKKVPKSPPKKPEVPP
VSVAEVPQEIVPDKKAPAAPPKKPEAPPVTVPEAPKEVVPEKKVPVMPPEKPKVPPVTVP
EAPTEVVTEKKVPVMPPKKPEVPPAKVPEAPKEVVPEKKVSVMPPKKSEVPPVTVPEAPK
DVVPEKEVPVMPPKKPEVPPAKVPEAPKEVVPEKKVPVMPPKKPEVPPAKVPEAPKDVVP
EKEVPVMPPKKPEVPPVTVPEAPKEVVPEKKVPVMPPKKPEVPPAKVPEVPKEVVPEKKA
PVAPPKKPEVPPVTVPVAPKEVVPEKKVPVMPPKKPEVPPVTVPEAPKEVVPEKKVPVMP
PKKPEVPPAKVPEVPKAAVPEKKVPEAIPPKPESPPPAVHEEPEETAPEEPPAEVMEEPE
PAPPPKVTVPPKKPVPEKKPPAVIAKKPEPPPVKVPEVPKEVVPEKKVPPVVPKKPEVPP
AKVPEVPKEVLPEKKVDVPKKPEVPPAKVPEVPKKPVLEEKPVVPVPEKVESPPPEVYEE
PVEIAPEEEEPVPVAEEEEPEVPPPAVPEEPKKIVPEKKFPVIKKAEPPPPKVPEMAKKV
VPVKKVPTVKKPETPEVKVSELPKKLVPVKKEPVPVTKKPEVRREKVPEVPKEVITEEKV
SVPTPEEPESPPVQVEESPEEIIYEERASITIGRKVTPPVEEREIEKYVKPEEPEPEPQP
EEIPVQEPEPEKKVIEKPKLKPRPPAPPPAPPKEDLKEKILQLKAVSKKKVPEKPEVLET
VELTPRKVLGGEKKVRKLLPEPKPQLKEEAVLKSVLRKRPEEEKPKEVEKIKKPAVPEPP
PKAVEEVEAPAAPVTKRERKVPEPAKVPEIKPAIPLPAPEPKPKPEPEVKIIKPPPLEPA
PAPIAAPVTVPVVGEKAGAKAPKEEAAKPKVPITGLAKKTPSPIEAERKKLRPGSGGEKP
PAEAPFTYQLKAVPLKFVKEIKDIVLTEAESVGASAIFECLVSPSTAVTSWMKDGSNIRE
SPKHRFIADGKDRKLHIIDVHLSDAGEYTCVLRLGNKEKTSTAKLIVEELPVRFVKTLEE
EVTVVKGQPLYLSCELNKERDVVWRKDGKIVVEKPGKIVPGIIGLMRALTISDADDFDAG
TYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAVFTCVIAKDTPNIKWFK
GYDEIPSEKTDKTEIVRDGKLIHLKIKNAMPEDIDEYAVEIEGKRYSAKLTLGDREVELL
KPIEDVTIYEKESASFDAEISEADIPGDWKLKGELLRPSPTCEIKADGGKRFLTLYKVKL
DQAGEVLYQALNAVTTAILTVKEIELDFAVPLKDVTVPEKRQARFECVLTREANVIWSKG
PDIIKSSDKFDIITDGKKHILVINNSQFDDEGVFTAEVEGKKTSARLFVTGIRLKFISPL
EDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKLHKLEMREVTLDDI
SQIKAQVKDLSSTANLKVLEADPYFTMKLHDKTGVEKDEIILKCEVSKDVPVKWFKDGEE
IVPSPKYSIKADGLRRILKIKKAKLKDKGEYTCDCGTDKTKANVTVEAQLIKVEKPLYGV
EVFVGETARFEIELSEPDVHGQWKLKGEPLTASPDCEIIEDGKKHILVLYNCRLDMTGEV
SFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTYRWLKGTQKIT
GDDKTELLKDGTRHSLVIRSAAFEDEAKYIFEAEDKHTSGKLIIEGIRLKFLTPLKDVTA
KERESAVFTVELSHDNIRVRWFKNDQRLHTSKLVSMHDEGKTHSITFKDLSIDDTSQIKV
EAMGLSSEAKLTVLEGDPYFTGKLQDYTGTEKDEVILQCEISKADAPVKWFKDGQEIKPS
KNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLEIEDREIKLVRPLYSVEVME
TETARFETEISEDGIHANWKLKGEALLQTPECEIKEEGKMHFLILHNCRLDQTGGVDFQA
ANVKSSAHLRVKPRAIGLLRPLKDVTVTAGETATFRCELSYEDIPVEWYLRGKKLEPSDK
VVTRSEGRVHALTLRDVKLEDAGEVQLVAKDFKTQANLFVKEPPVEFTKPLEDQTVEEEA
TAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLIIHGCTPEDIKTYTCDAKD
FKTSCNLNVVPPHVDFLRPLTDLQVKEKEMARFECEISRENAKVQWFKDGAEIKKGKKYD
IISKGAVRILVINKCLLADEAEYSCEVRTARTSGMLTVLEEEAIFTKNLTNIEVSETDTV
KLVCEVSKPGAEVIWYKGDEEIIETGRYEILTVGRKRTLIIQNAHLEDTGNYNCRLPSSR
TDGKVKVHELAAEFISKPQNVEILEGEKAEFVCSISKESFAVQWKRDDKTLEPGDKYDII
ADGKKRILVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIIVPLKNTRVKEQQEAVFN
CEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDARLDDQANYNVSLTNHRGEN
VKSAANLIVEEEDLRIIEPLKDIETMEKKSVTFWCKVNRLNVRLNWTKNGEEVAFDNRVL
YRIDKYKHSLIIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDA
VFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGRIHRLIIKDCRLDDECEYACGVEDRR
SRARLFVEEIPVEIIRPPQDILEAPGTDVVFLAELNKDKVEVQWLKNNMIIVQGDKHQMM
SEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGQPLTMV
VPYDAYPKAEAEWFKENEPLSSKTIDTTAEQTSFRILEAKKRDKGRYKIVLQNKHGKAEA
FINLQVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLAT
DRADSCEFTVTRLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKYDVPGPPLNVTIT
DVDRFGVSLTWEPPEYDGGAEITNYIIELRDKTSIRWETAMTVRAEDLSATVTDVVEGQE
YSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLNSSDQTQSSVQLTWEPPLKDGG
GPILGYIIERCEEGKDNWIRCNKKLVPELTYKVTGLQKGNKYLYRVSAENEAGVSDPSEI
LGPLTADDAFVEPTMDLSAFKDGLEVIVPNPIKILVPSTGYPRPTATWSFGDKVLEAGDR
VKMKTLSAYAELIISPSERPDKGIYMLKLENRVKTISGEVDVRVIARPSAPKELKFGEIT
KDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVIDSVTNLEFTVTDLVQGKEYLFK
VCAHNKCGPGEPAYVDEPVNMSAPATVPDPPENVKWRDRTAKSIFLTWDPPKHDGGSRIK
GYIVEKCPRGSDRWVACGEPVAETKMEVTGLEEGQWYAYRVKALNRLGASKPSKPTEEIQ
AVDIQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKVTWTKADTLLKQDKRITIE
NVPKKSTVTIVDSKRSDSGTYIIEAMNVCGRATAVVEVNVLDKPGPPAALDIMEVTSESC
FLTWNPPRDDGGSKITNYVVERRATDSDMWHKLSSTVKDTKFKATKLTPNKEYIFRVAAE
NMYGVGEPVQTTPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVE
RLDPDTDKWVRCNKMPIKDTTYRVKGLTNKKKYRFRVLAENLAGPGKSSRSTEPILIKDP
IDPPWPPGKPTVKDVGRTSLMLNWTKPEHDGGAKIESYVIEMLKTGTEDWVRVAEGVPTT
QHLFPGLMEGQEYSFRVRAVNKAGESEPSEPSDSVLCREKLYPPSPPRWLEVINITKNTA
DLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAE
NAIGQSDYCEVEDSVLAKDTFTTPGPPYALTVVDVTKGHVDLKWEPPKNDGGRPIQRYVI
EKKEKLGTRWVKAAKTSGPDCNFKVTDVIEGTEVQFQVRAENEAGIGHPSEPTEILKIED
PTSPPSSPLDLHVTDAGRKHITIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIK
DLKFKVEEGVVPDKEYVLRVRAVNAVGVSEPSEISENVVAKDPDCKPTIDLETHDIVVIE
GEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKKDHISAHLEVPKSVHADAGVYTIT
LENTLGSATASINVKVIGLPGPCKDLKASDVTKSSCKLTWEPPEYDGGSPILHYVLERRE
AGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKIGGGEYIELKNPVIAQDPKQPP
DPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPVLTYT
AKGLEEGKEYQFRVRAENAAGIGEPSRATPPTKALDPIDAPKVIMRTSLEVRRGDEIALD
ATISGSPYPTITWLKDENVITPEEIRKRVAPLVRRKKGEVQEEERFVLPLTQRLSIDNSK
KGESQLRVRDSLRPDHGLFMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVVC
KWEPPLDDGGSEILNYTLEKKDKTKPDSEWIAVTSTLRHCKYSVTKLIEGKEYLFRVRAE
NRFGPGPPCVSKPLTAKDPFEPPDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGYWLEK
REVNSTHWSRVNRNLLNSLKTNAEGLLEGLTYVFRVRAENAAGPGKFSPPSDPKTAHDPI
SPPGPPVPRVTDTSSTTIELAWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKARE
YTVKEIREGADYKLRVSAVNAAGEGPPGETEPVTVAEPQEPPNVELDVSVKAGIQIMAGK
TLRIPAVVTGRPVPTKVWTIEEGELDKDRVEIENVGTKSELIIKNALRKDHGRYVITATN
SCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPADDGGSDITGFIIERKDAKM
HTWRQPIETERSKCDITGLLEGQEYMYRVIAKNKFGCGPPVEVGPILAVDPLGPPTSPER
LTYTERTKSTINLDWKEPRNNGGCPIQGYIIEKRRQDKPDFERVNKRLCPTTSLLVEDLD
EHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVNIPA
DVTGLPMPKIEWSKNETMIEKPTDALKITKEEVSRSEAKTELSIPKATREDKGTYTVTAS
NRLGSVFRNVHVEVYDRPSPPRNLAVIDIKAESCYLTWDAPLDNGGGEITHYVIDKRDAS
RKKAEWEEVTNTAVERRYGIWKLIPNGQYEFRVRAVNKYGTSDECKSDKVVIQDPYRTPG
PPGKPKVLERTKGSMLVSWTPPLDNGGSPITGYWLEKREEGGAYWSRVSRAPITKVGLKG
VEFNVPHLIEDVKYQFRAMAINAAGVGSPSEPSDLAVAGDPIYPPGPPSHPEVKDKTKSS
ISLAWKPPAKDGGSPIKGYIVEMQEEGTTDWKSVNEPDKLLTTCECVVPNLKELRKYRFR
VKAVNEAGESEPSDTTGEIPATDIQEVPEIFIDIGAQDCLICQAGTHIRIPAVIKGRPTP
KSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHSGKYSITAKNKAGQK
TANCRVKVMDVPGPPKDLKVSDITRGSCRLTWKMPDDDGGDRIKGYVIEKRTIDGKAWTK
VNPNCGSTSFVVPDLISEQEYFFRVRAQNRFGIGAPVETIQRTTARDPIYPPDPPIKLKI
GLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWKQCNKRDVEELEFTVED
LVEGGEYEFRVKAVNAAGVSKPSAIVGPVTVKDQTCPPSIELKEFMEVEEGTDVSIVAKI
KGVPFPTLTWFKAPPKKPDNKEPVVYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVN
NLGTASKEMRLNVLGRPGPPVGPIKFESISADQMTLSWLPPKDDGGSKITNYVIEKREAN
RKTWVRVSSEPKECTYTIPKLLEDHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAP
DKPTVSSVTRSSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSH
KVTGLIEGSDYQFRVYAINAAGVGPASLPSDPVTARDPIAPPGPPFPKVTDWTKSSADLE
WSPPLKDGGSKITGYIVEYKEEGKEEWEKAKEKEVRGTKLVVTGLKEGAFYKFRVRAVNI
AGIGEPGEVTDAIEMKDRIVLPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWSM
NERALPQEATIETTAISSSMVIKNCQRSHQGVYALLAKNAGGERKKTIIVDVLDVPGPVG
IPFLSHNLTNDSCKLTWFSPEDDGGSPVTNYVIEKREDDRRAWTPVTYTVTRQNATVQGL
IQGKAYFFRIAAENSIGMGPFVETTDALVIRDPITVPERPEDLEVKEVAKDSVTLTWNPP
KYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAINIVGQG
KPSFCTKPITCKDELAPPTLDLDFRDKLTIRVGEAFALTGRYSGKPKPKVTWFKDEVDVL
EDDRTHIKTSPTTLALEKLKAKRSDSGKYCVVVENSTGSRKGFCKVNVVDRPGPPVGPVV
FDEVTKDYMVISWKPPLDDGGSEITNYIIEKKEVGKDVWMPVTSASAKTTYKVSKLLEGK
DYIFRIHAENLYGISDPLVSDSMKAKERFRVPDAPDQPIVTEVTKDSALVTWNKPSDGGK
PITNYILEKRETMSKRWARVTKEPIHPYTKFTVPDLLEGCQYEFRVSAENQIGIGDPSPP
SKPVFAKDPIVKPSPPINPEAIDTTHNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWK
RANHTPESCPETNYKVTGLRDGQSYKFRVLAVNVASESDPAHVPEPVLVKDRLEPPELIL
DANMAREQHIRVGDTLRLSAVIKGVPFPKVTWKKEDREAPTKARIDVTPVGSKLEICNAA
HEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSV
ITNYVVERRDVASAQWSPLSTTSKKKSHFAKHLTEGSQYLFRVAAENQYGRGPFVETSKP
IKALDPLHPPGPPKNLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFK
TVTNSECVVNGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGL
VVKAGTTVRFPAIIRGVPVPTAKWTTDGNEIKTDEHHTVETDNFSSVLTIKNCLRRDTGE
YQITVSNAAGTKTVAVHLTVLDVPGPPTGPINILEITPEHMTISWQPPKDDGGSPVINYI
VEKKDTKKDTWGVVSSGSSKTKLKVPHLQKGCEYVFRVKAENKIGVGPPLDSIPTVAKHK
FSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYVERREVTGKWMRVNKTPLADL
KFRVTGLYEGNTYEFRVFAENLAGLSNPSPSSDPIKACRPIKPPGPPINPKLKDKTRETA
DLVWTKPLSDGGSPILGYVVECQKAGATQWSRINKDELIRQCAFRVPGLIEGNEYRFRIK
AANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPQPDI
TWSKEGKVLAREKRVDLIHDLPRAELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD
RPGPCQNLKISNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI
KANLLANNEYYFRVCAENKVGVGPTTETKTPILAINPIDRPGEPENLHIADKGKTFVYLK
WRRPDYDGGSPNLSYHVERKLKGSDDWERVHKGGIKETHYMVDKCVENQIYEFRVQTKNE
GGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDAIRLEAGVRGKPFPEVSWTKDKD
ATDLTRSPRAKIVTSGDSSKFTLTKAERSDGGKYVITATNTAGSFVAFATVNVLDKPGPV
RNLKIVDVCSDRCSLRWDPPEDDGGCEIQNYILEKCESKRMVWSTFSATILIPGTTVTRL
IEGNEYIFRVRAENKIGTGPPTESKPVIAKTKYDRPGRPDTPEVTKVSNEEMTVVWTPPE
YDGGKSITGYYLEKKEKHSTRWVPVNKSAIPERRLKVQNLLPGHEYQFRVKAENEVGIGE
PSLPSRPVVAKDPIEPPGPPTNLKVVDTTKSTITLGWGKPVYDGGAPIIGYVVEMRPKRP
DTSPDEGWKRCSAAVQLVRMEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKDAIKPKEI
LEPPEIDLDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTM
AFLVIPNSTRDDSGKYSLTLVNLAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHISWA
PPENDGGSQVTHYIVQKREADRKTWSTVTPEVKKTSFQVTNLVPGTEYFFRVTAVNEYGP
GVPTDIPKPVLATDPLSEPDPPRKLEVTEMTKNSAALAWLPPLRDGGAKVDGYIVSYREE
EQPAGRWTQYSVVKDLSLVITGLMEGKKYKFRVAARNAVGVSLPREAEGVYEAKAQLLPP
KILMPEQVIIKAGKKLRIEAHVYGKPHPICKWKKGEDEVVTSSHLAVHKADNSSVLIVKD
VTRKDSGYYSLTAENSSGTDTQKIRVIVMDVPGPPQPPFDISDIDADACSLSWHIPLEDG
GSNVTNYIVEKCDVSRGDWVIALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTS
PKMLAEFPFDVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPITGYLIERKERNSLLWVK
ANDTPVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARTPVDPPGKPEVID
VSKSTVSLIWARPKHDGGSKITGYFVEACKLPGDKWVRCNTSPHQIPQEEYTATGLEENA
QYQFRAIAKTAVNISQPSEPSDPVTIVAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVF
GKPMPTVSWKKDGTPLKASEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENASGSKSAT
IKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYVVDKRETSRPNWAQVSA
TVPITSCSVEKLIEGHEYQFRICAENKYGVGEPILTEPAIAKNPYDPPGRCDPPVISNIT
KDHMTVSWKPPADDGGSPITGYLVEKRETQAINWTKVNRKPVIERTIKATGLQEGTEYEF
RVTAINKAGPGKPSDASKAAYAQDPLYPPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPI
IGYLVEVKRADSDNWVRCNLPQKLQKTRFEVTGLMENTEYQFRVYAVNKIGYSDPSDVPD
KHCPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRERIGL
DIKSTDFDTFLRCENVNKYDAGKYILTLKNSCGQKEYTIVVKVLDTPGPPINVTVKEISK
DSAYVTWDPPIIDGGSPIINYVVEKRDAERKSWSTVTTECSKTSFRVSNLEEGKSYFFRV
FAENEYGIGDPSETRDAVKASETPGPVVDLKVTSVTKSSCSIGWKKPRSDGGSRIIGYVV
DILTEENKWQRVTKSLNLQYSMKDLTEGEEYTFRVSAENENGEGTPSEITVVAKDDVVAP
DLDLKDLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTL
VVNDCQKSDAGKYTITLKNVAGTKEGTLSIKVVGKPGIPTGPIKFDEVTAEAMTLKWGPP
KDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVMRLHEGMEYTFRVSAENKYGVGE
GLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPRRNGGSPITGYHIEFKERNSL
LWKRANKTPVRMKDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKP
EVINVTRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPDCAFTVTDLVE
GGKYEFRIRAKNTAGAISAPSESTGTIICKDEYEAPTIVLDPTIKDGLTVKAGDTIVLNA
ISILGKPLPKSSWSRAGKDIRPSDIIQITSTPTSSMLAIKYATRKDAGEYTITATNAFGT
KEEHVKVIVLDVPGPPGPIEVSNVSAEKATLTWTPPLEDGGSPIKSYVLEKRETSRLLWT
VVAEDIQSCRHVATKLIQGNEYLFRVSAVNQYGKGEPVQSEPVKMVDRFGPPGPPGKPEV
SNVTKNTATVSWKRPVDDGGSEITGYHVERREKKGLRWVRATGTPVSDLRCKVTGLQEGN
TYEFRVSAENKAGIGPPSDTSNPVLMKDVAYPPGPPSNARVTDTTKKSASLAWGKPHYDG
GLEITGYVVEHQKVGDDAWIKDTTGTTLRITEFVVPDLQTKEKYNFRISAINDAGVGEPA
VISNVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDDINLKKR
ANIESTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDIT
KESVTLNWDLPLIDGGSHITNYIVEKREATRKSYSTVTTKCPKCTYKVTGLSEGCEYFFR
VMAENEYGIGEPTETTEPVRASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYV
IEAQRKGSDQWTHITTVKGLECVVKNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQT
MLPGLDLHGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGEQVLKQTQRVNFENTATS
TILNINECLRSDSGLYPLTAKNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSW
DPPENDGGVPISNYVVEMRQTDSTTWVELAATVIRTTYKATHLTTGVEYQFRVKAQNRYG
VGPGITSASVAANYPFKVPGPPGTPQVTAVTKDSITISWHEPLSDGGSPILGYHIERKER
NSILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDQP
GKPVPLNITRHTVTLQWAKPEYTGGFKITSYIVEKRDFPNGRWLKANFSNILENEFTVSG
LTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDIEAPRIMVDIKFKDTIIIKAGEEFK
LEADVSGRPPPTMEWTKDGKELENTAKLEIKVADFSTNLVNKDSLRRDGGAYTLTATNPG
GFAKHIFNVKVLDRPGPPEGPLAVSEVTSEKCVLSWLPPLDDGGAKIDHYVVQKRETSRL
AWTNVASEVQVTRLKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPVLALDPYGPPDPPKN
PEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWVKCNRKTLTDLRYKVSGLT
EGHEYEFRIMAENAAGISAPSTTSPFYKACDAVFKPGPPGNPRVLDTSRSSISIAWNKPI
YDGGSEITGYMVETALPEEDEWHIVTPPAGLRATSYTITNLTENQEYKIRIYAMNSEGIG
EPAFVPGTPKAEDRMLPPEIELDAELRKVVTIRACCTLRLFVPIKGRPVPEVKWTREHGE
SLDKASIESTSSYTLLIVGNVNRFDSGKYILTIENSSGSKSAFVSVRVLDTPGPPQDLKV
KEVTKTSVTLTWEPPLLDGGSKISNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCS
YYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLVDVTRTSVSLSWEKPEHDGGSRI
LGYIVEMQSKSSDKWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVV
AKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPTATWHKDDVPLKQTTRVNAESTE
NNSLLTIKEACREDVGHYVVKLTNSAGEATETLNVIVLDKPGPPTGPVKMDEVTADSITF
SWGPPKYDGGSSISNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENR
YGKSTYLNSEPTVAQYPFKVPGPPGTPFVTLSSKDSMEVQWNEPVSDGGSKVIGYHLERK
ERNSILWVKLNKTPIPQTKFKTTGLDEGIEYEFRVSAQNIVGIGKPSKVSESYVARDPCD
PPGRPEPIIVTRNSVTLQWKKPTYDGGSKVTGYIVEKKELPEGRWMKASFTNVIDTQFEV
TGLAEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVEPPRIRMDPKYKDTIVVHAGEL
FNIDADIYGKPVPATQWIKGDQELSNTARLEIKSTDFATSLNVKDAIRVDSGNYILKAKN
VAGEISVTVNVKVLDRPGPPEGPIVISGVTAEKCTLTWKPPLQDGGSDIMNYIVEKRETS
RLVWTVVDANVQTLSCKLTKLLEGNEYIFRIMAVNRYGVGEPLESEPVIVKNPFVVPDAP
KAPEITAVTKDSMVVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTG
LLENHNYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSIFLSWGK
PIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAVNKVG
VGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIRGRPTPEVKWGKVD
GEIRDAAIIDSTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKTAFVTVRVLDTPSPPVNL
KVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEG
CSYYFRVTAENEYGIGLPAHTDDPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGS
KIIQYIVEMQAKHREKWSECARVKFLEAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP
VVAKDLVIEPDVRPAFNNYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTD
SLDLTILSIKETHKDDSGHYGITVANVVGQKTASIEIITLDKPDPPKGPVKFDEVSAESI
TLSWEPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAE
NRYGQSFALESEPIVAQYPYKEPGPPGTPFVTAISKDSMVIQWHEPINNGGSPIIGYHLE
RKERNSILWTKVNKTIIHDTQFKALNLEEGIGYEFRVYAENIVGIGKASKNSECYVARDP
CDPPGTPEAIIVKRHEITLQWTKPAYDGGSMITGYIVEKRDLPEGRWMKASFTNVIETQF
TVSGLTEDQRYEFRVIAKNAAGTISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAG
ETFRLEADVHGKPLPTIEWLRGDKEIEESARCEINNTDFKALLIVKDAIRIDGGQYILRA
SNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTAEKCTLTWSPPLQDGGSNISHYVVEKRE
TSRLAWTVVASEVVTNSLKVTKLLEGNEYIFRIMAVNKYGVGEPLESAPVLMKNPFVLPG
PPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDKSGIRWLKCNKRRITDLRLRV
TGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPINAHIVDTTKNSFTLAW
GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRATRFEISKLTEHQEYKIRVCALNK
VGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSVRIHIPFKGCPTPEITWSR
EEGEFTDKVQTEKAANYTQLSIDNCDRNDAGKYTLKLENSSGSKSAFITVKVLDTPGPLQ
NLAVKEVRKDFVLLIWEPPIIDGGSKVKNYVIDKRESTRKAYANVSNKCSKTSFKVENLT
EGAMYYFRVMAENEFGVGVPVETTDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDG
GSRILGYVVEMQPKGTEKWSVVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLG
VPVIAKDLTIQPSFKLQFNTYSVQAGEDLKIEIPVIGRPRPEISWVKDGEPLKQTTRVNV
EETATSTILHIIESNKDDFGKYTITATNSAGTATENLSIIVLEKPGPPVGPVRFDEVSAT
FVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKIPKLKTGTEYQFRIF
AENRYGKSAPLDSKPVIVQYPFKEPGPPGTPFVTSVSKDQMLVQWHEPVNDGGSKVIGYH
LEQKERNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR
DPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKIIGYIVEKKDLPDGRWMKASFTNVLET
EYTVSGLVEDQRYEFRVIARNAAGNFSEPSESTGAITARDEIDAPNASLDPRYKDVIVVH
AGDTFVLEADIRGTPIPDIVWSKDGKELEETAARMEIKSTIQKTTVLVKDCIRSDGGQYI
LKLSNVGGTKSIPITVKVLDRPGPPEGPLKVSGVTAEKCYLAWNPPLQDGGANISHYIIE
KRETSRLSWTQVSTEVQTLNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESEPVVACNPYK
PPGPPSPPEASAIAKESMVVTWARPVDDGGAEIEGYILEKRDKAGIRWTKCNKKTLTDLR
FRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNLKVTDTSRSSVS
LVWNKPIYDGGAPVKGYVVEVKEATAAEWTMCTPPTGLQGKQFTVTKLKENTEYNFRICA
INSEGVGEPATIPGSVVAKERQEPPEIELDADLRKVVILRASATLRLFVTIKGRPEPEVK
WEKAEGVLTDRAQIEVTSSYTMLVIDNVTRFDSGRYNLTLENNSGSKTVFVNVRVLDSPS
APVNLTVGEVKKDSVTLAWEPPLIDGGAKITNYIVEKRETTRKVYATVTNNCTKNTFKIE
NLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSETPLPPGRVTLVDVTRNTATIKWERPE
SDGGSKITGYVVEMQTKGSEKWSICTQVKTLEATISGLTAGEEYIFRVAALNEKGKSDPR
QLGVPVIARDVEIKPSVELPFNTFNVKARDQLKIDVPFKGRPQATVSWKKDGQTLKETTR
VNVSSSKTITSLTIKEASREDVGTYELCVSNTAGSITLPITIIVLDKPGPPGPIHIDEVS
CDNITVSWNPPEYDGGCQISNYIIEKRETSSTTWHVVSQAVARTSIKIVRLVTGSEYQFR
VCAENRYGKSSYSASSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSQVLG
YHLEYKERSSILWSKANKSLITDTQKKVSGLDEGLMYEYRVYAETIAGIGKYSKSCEPVP
ARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNFTNVQ
ETYFEVAELTEDQRYEFRVFARNAADSTSEPSESTGPITVKDDVEAPRIMMDVKFRDVIV
VKAGEVLKINADIAGRPLPVMSWAKDGVEIEERARTEIVSTDYNTLLTVKDCVRRDSGQY
VLTLKNVAGTRSLAVNCKVLDKPGPPAGPLEITGLTAEKCSVSWGPPQEDGGAAIDYYIV
EKRETSRLAWTICEGELRTTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAVKALDPF
TVPSPPTSLEITSVTKEFMTLCWARPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDL
RVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIQAEDPVFLPSPPSKPNIMDSGKTNI
TIGWVKPLFDGGSPVTGYTVEFKKSDETDWKTAIQNLRGTEYTISGLTTGAEYIFRIRSI
NKVGASDPSDSSDPQIAKEREEEPVFDLDSEMKKTLIVKAGASFTMTVRFRGRPVPSVSW
SKPDTDLRTRAYIDSTESRTSLTIENANRNDSGKYTLTIQNILNAASLTLVVKVLDSPGP
PANITVHDVTRESAVLSWDVPENDGGAPVKNYYIEKREASKKAWVSVTSNCNRLSYKITN
LQEGEIYYFRVSGENEFGVGVPAETKEGVKITEKPSPPEKLGVTSVSKDSVSLAWLKPEH
DGGSRIVHYVTEALEKGQKNWVRCAVVKSTHHVISGLRENSEYFFRVFAENQAGLSDPRE
LLLPVLVKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKAT
MRFNTEITAENLTINLKESIAADAGRYEITAANSSGTTKAFINIIILDRPGPATGPVVIS
DVTEESVTLKWEPPKYDGGSQVTNYIVLKRETSTAVWTEVSATVARTMIKVMKLTTGEEY
QFRIKAENRFGISDHIDSACVVVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSSGGSA
VIGYHLEMKDRNTILWQKANKMVIRTTHFTVTTISAGLVYEFRVYAENAAGIGKPSHPSE
PVLAIDACESPRNVRITDVSKNSVNLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFT
NVTETQLTVSGLTQNSQYEFRVFARNAVGSISNPSEVAGPITCIDSYGGPIIDLPLEYTE
VVKYRAGTSVKLRAGISGKPEPTIEWYKDDKELQTSALLCVENTTDLAAILIKDANRLNS
GSYELKLRNAIGSASATIRVQILDKPGPPGGPIEFKTVTATKITLLWQPPADDGGAKITH
YIVEKRETSRVVWSMVSENLEECIITTTKIIKGNEYIFRVRAVNKYGIGDALESHPVVAR
NAFVTPGPPSVPEVTKITKNSMTVVWNRPVADGGSDIRGYFLEKRDKKSLGWFKVLKETI
RDTRQKVTGLTEHSDYQYRVCAINAAGQGPFSEPSDFYKAADPIDPPGPPAKIRIEDSTK
SSITLGWSKPVYNGGSAVTGYVVGMRQGEEEEWTVVSTKGEVRTTEYVVSNLKPGVNYYF
QVSAVNCAGQGEPIEMTEPVQAKDILEEPEIDLDVALRASIIAKAGEDVQVLIPFKGRPP
PTVTWRKDEKNLGSDARYSIQNTDSSSLLTIPQVTRNDMGKYILTIENGIGQPKSSTVSV
KVLDTPAACQKLQIKHVSRGTVTLLWESPLIDGGFPIINYIIEKKDATKRTWSSVSHKCS
STSFKVTDLSEKTPFFFRVFAENEIGIGEPCETTKPVKAAEVPAPICDLSVKDSTKTSVT
LSWTKPDFDGGSVITDYIVERKGKGEQTWSHAGISKTCEIEVSQLKELSVLEFRVSARNE
KGLSDGVTIGPITVKELVIPPQIDLSEIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKD
GLPLKESERVRLSKTENKLTLSIKNAKKENGGKYTIILDNAVCRNSFPITIITLGPPSKP
KGPIRFDEIKADSVIISWDVPDDDGGGEITCYSIEKREASQTNWKMVCSSVARTTFKVPN
LVKDAEYQFRVRAENRYGVSQPLDSNIIVAKHQFRIPGPPGKPVTYNVTSDGMSLTWDAP
VYDGGSEVTGYHVEKKERNSILWQRVNTSPISGREHRATGLMEGLDYQFRVYAENSAGLS
SPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVAYNIEKRQGSDHW
TRCNFSDVSECQYTATGLSPGDRYEFRILARNAVGTISPPSQSSGVIMTRDENVAPIVEF
GPEYFDGVTIKSGESLRIKALVQGRPVPRVTWFRDGEEIEKRMNMEITNVLGSTSLFVRD
ATRDHRGVYRVEAKNASGSTKAEITVKVQDTPGKPVGPIRFTSITGEKMTLWWNAPLNDG
CAPVSHYIIEKRETSRLAWALIEDNCEALSYTATKLITGNEYQFRISAVNKFGVGRPLDS
DPVVAQIQYTIPDSPGTPEPSNVTGNSITLTWARPESDGGSEIQQYILERREKKSTRWVK
VISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISTLIKCREPVNPPSAPTVV
KVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEGCVKTRYTVTDLQA
GEEYKFRVSAVNGAGKGDSCEVTGTIKAVDRLSAPELDIDANFKQTHIVRAGASIRLFIA
YQGRPTPTAVWSKPDSNLSIRADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSIT
FTVKVLDSPGPPGPITFKDVTRGSVTLMWDAPLLDGGARIHHYVVEKREASRRSWQVVSE
KCTRQILKVNDLVEGVPYYFRVSAENEYGVGEPYEMPEPMVATEQPAPPKRLDVIDTSKS
SVVLAWLKPDHDGGSRISGYLLEMRQKGSDFWVEAGHTKQLTFTVEHLTENTEYEFRVKA
KNDAGYGEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSTFTIDVPISGRPAPKVT
WKLEEMRLKETDRVSITTTKDRTTLSVKDSMRGDSGRYFLTLENTAGVKTFTITVVVIGR
PGPVTGPIEVSSVSAESCILSWAEPKDDGGTDITNYIVEKRESGTTAWQLVNSSVKRTQI
KVTHLTKYMEYSFRVSSENRFGVSKPLESAPIVAEHPFVPPSAPTRPEVYCVSANAMSIR
WEEPYHDGGSKVIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNV
AGVSKASEASRPMMAQNPVDAPGRPEVTDVTRSTVSLIWSAPVYDGGSKVVGYIIERKPV
SEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPITCRDE
YAPPKAELDARLQGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTG
KRATAVIKFCDRSDSGRYTLMVKNASGTKAVSVVVKVLDSPGPCGKLTVSRVTEEKCTLA
WSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKY
GPGVPVESEPIVARNSFTIPSQPGIPEEVGAGKEHIIIQWTKPESDGGNEISNYLVDKRE
KKSLRWTRVNKDHVVYDTRLKVTGLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSY
TPGPPSAPRVVDTTKHSISLAWTKPMYDGGTDIIGYVLEMQEKDTDQWYRVHTNTTIRNN
EFTVTDLKMGQKYSFRVAAVNVKGMSEYSESTAEIEPMERLEIPDLELADDLKKIVTIRA
GSSLRLMVSVSGRPPPVTTWSKKGIDLASRAIIDNTESYSLLIVDKVNRYDAGKYTIEAE
NQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEVPTIDGGAPVNNYIIEKREAA
MRAFKTVTTKCSKTLYRISGLIEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPVK
LEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVISLN
EGEQYLFRVRAQNEKGVSEPREIITAVTVQDLRVLPAIDLSTMPQKTIHVPAGRPVELVI
PIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGDYILELKNATGTT
SETIKVIILDKPGPPTGPIKIEEIDATSVTISWGPPELDGGAPLSGYVVEQRDAHRPGWL
PVSESVTRTTFKFTRLTEGNEYVFRIAATNRFGIGSYLQSEAIECRSRINIPGPPETLQI
FDVSREGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLIEGL
EYEHRVTAINVRGTGKPSRPSKPTIAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEG
GSKVTGYLIEMQKVDQYEWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAE
VPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKR
AMIATSETHTELVIKEADRDDSGTYDLVLENKCGKKAVYIKVRVIGSPNTPEGPLEYDDI
QARSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHF
RVSAENQFGISKPLKSEEPVIPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPRDDGGSR
VTGYYIERKETSTDKWVRHNKTQITTTMYTITGLVPDAEYQFRIIAQNDIGLSETSPASE
PVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKS
NKDRIKDRQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSVRTKLTSGEAPGVRKEMK
DVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDE
GIYTCVATNEVGEVESSSKLLLQAMPQFHPGYPLKEKYYGAVGSTLRLHVTYIGRPVPAI
AWFHGQKLLQNSENIAIENTEQYTHLVMKNIQRKTHAGKYKVQLSNVLGTVDTILDVEIQ
DKPDKPTGPIVIEALLKNSVVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISV
TTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGTPGKPTIAAVTKDS
CVVAWKPPASDGGAKIRNYYLEKREKKQNKWIAVTTDEIRETVFSVQNLIEGLEYEFRVK
CENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYHSNATLVCKVTGHPKPIVK
WYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE
VPAKIHLPKNLEGMGAVHALRGEVISIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTR
SFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNL
TWTEPASDGGSKITNYIVEKCATTAERWIRVGQARETHYTVINLFGKTSYQFRIIAENKF
GLSKPSEPSEPTITKEDKTRAMNYDEEVDETREVSMTKASHSSTKELYEKYMIAEDLGRG
QFGIVHRCVETSSKKTYMAKFVKVKGTDQVLVKKEISILNIARHRNILYLHESFESMEEL
VMIFEFISGLDIFERINTSAFELNEREIVSYVRQVCEALEFLHSHNIGHFDIRPENIIYQ
TRRSSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVL
LSGINPFLAETNQQVIENIMNAEYTFDEEAFQEISLEAMDFVDRLLVKERKSRMTASEAL
QHPWLKQKIERVSTKVIRTLKHRRYYHALIKKDLNLVVSAARISCGGAIRSQKGVSVAKV
KVASIEIGPVSGQIMHAVVDEGGYVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYD
DGVATMYVKDITKFDDGTYRCKVVNDYGEDSSYAELFVKGVREIYDYYCRRTIKKIKRRT
DTMRLLERPPEFTLPLYNKTVYVGENVRFGVTITVHPEPRVTWYKSGQKIKPGDDDRKYT
FESDKGLYQLTINSVTTDDAAEYTVVARNKYGEDSCKAKLTVTPHPPPTGTTLRPMFKRL
LANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLP
EDTGYYRVTATNTAGSTSCQAHLQVERLRYVKQEFKTKEERERHVQRQIDKTLRMAEILS
GTETVPLTQVAQEALREAAILYKPAVSTKTVKGEYRLETEEKKEERKLRMPYEVPEPRKY
KPDAIEEDQRIKQFVPMSDMKWYKKIRDQFEMPGKMDRVVQKRPKRIRLSRWEQFYVMPL
PRITDQYRPKWRIPKLSQDDLEMVRPARQHTPSPDYYFYYRPRRRSLGDISDEELLLPID
DYLAMKRTEEERLRLEEELELGFSASPPSRSPPRFELSSLRYPSPQAHVKVEEARKDFRY
STYHIPTKAETSMSYAELRERHARASHRQPRQRQRIMAEREDQELLRPVTTTQRLSEYKS
ELDHMAKEEKSRKKSRRQREVTEITEIEEEYEISKHSQRDTSSSVSRLLRRRRSLSPTYI
ELMRPVSELIRPRPQPAEEYEYEDDVERRSPTPERTRPRSPSPVSSERSLSRFERSARFD
IFSRYESMKAALKTQKTSERKYEVLSQQPFTLDHMPRITLRMRSHRVPCGQNTRFILNVQ
SKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHIDDGGTYRAVCTNYKGEASDY
ATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREMKSQM
TETRESLSSYEHYASAEMKSAAVEEKSLEEKSTHRKIKTTLAARILTKPRSITVYEGDSA
RFSCDTDGEPVPTVTWLRRGQVISTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENS
EGKQEAQFTLTIQKARVTEKALTSPPKVKSPEPRVKSPEGVKSPKQVKSPEPVTSHPKAV
SPTETKPTPTEKAQQLPVTAPPTIIQSLKAEASKDIAKLTCVVESTVLCAKEVAWYKDGK
KLKENGHFQFHYSADGTYELKIHNLTESDCGEYVCEISGEGGTSKTNFQFVGQAFKNIHE
EVSSISETKKAAQKTAEPAETKKAAPKTAEPTETKKAAPKTAEPTETKKTEPKAPEPVST
KPVIVTGLQDTTISSDSVTKFAVKATGEPQPTVIWTKDGKAITQGGKYKLSEEKGGFFLE
IHKTDTSDGGLYTCTITNSAGSVSSSCKLTIKAVKDTEIQKVSTQKTSKSTSQKKEAVQE
EISKKALISEEIKMSEVKSPEKLALKEEASTVLISEKVKKSEATSLEKSIVHEEITKTSQ
ASEEIRTHAEIKAYSTQMSIPDGQKVTLKANIAGATDVKWVLNGVELSNSEEYRYGVSGS
DQTLTIKQAGHKDEGILTCIGKTSQGIIKCQYDLTLSKELSDAPAFISQPRSQNVNEGQN
VLFSCEISGEPSPEIEWFKNNLPISVSSNISVSRSRNVYSLEIRNASVSDSGKYTIKAKN
FHGQCSATASLTVLPLVEEPPREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSS
SASSMTEMKFASMSAQSMSSMQQSFVEMSSSSFMGKSSMTQLESSTSRMLKAGLRGIPPK
IEALPSDISIDEGKVLTVACAFTGEPTPEITWCHGGRKIQNQEQQGRFHTENTDDLTTLI
IMDVQKQDGGLYTLSLENEFGSDSATVNINIRSI
NT seq 105405 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaagcaccgacgtttacgcagccgttacaaagcgttgtggtactggagggt
agtaccgcaacctttgaggctcacattagtggtttcccagttcctgaggtgagctggttt
agggatggccaggtgatttccacttccactctgcccggcgtgcagatctcctttagcgac
ggccgcgctagactgatgatccccgccgtgactaaagccaacagtggacgatactccctg
agagccaccaatggatctggacaagcgactagtactgctgagcttctcgtgacagcggag
acagcgccacccaactttgttcaacggctgcagagcatgaccgtgagacaaggaagccaa
gtgcgactccaagtgagagtgactggaatccctacacctgtggtgaagttctaccgggac
ggagctgaaatccacagctcccttgattttcaaatttcacaagaaggcgacctctacagc
ttactgattgcggaagcataccctgaagactctggcacttattcagtaaatgccaccaat
agcgttggaagagctacttccactgctgaattactggttcaaggtgaagaagtagtgccc
gctaaaaagacgaagacaattgtttcgactgctcagatttcagaaacacgacaaactcaa
attgaaaagaagattgaagcccactttgatgccagatcaattgcaacagttgagatggta
atagatggtgccactgggcaacagctgccacataaaacacctcccaggatacctcctaag
ccaaagtcaaggtctcccacaccaccatccattgctgccaaagcacagttggctcgacag
cagtccccatcgccgataagacactccccgtccccggtcagacatgtgcgggcaccgacc
ccatctcccgtcaggtccgtgtctccagcggggcggatctccacgtcccccatcagatcc
attaagtctccgttactcgtccggaaggctcagatgcccaccatgcccccaggccccgaa
gtgcctcccccgtggaagcaagagggctacatggcttcatctgagtctgagatgagagaa
accatggtgacaagtgctactcagatcaggacagaggagagatgggaagggagatacggg
atccaggagcaagtgaccatcagcggagcggcaggggctgccgccagtgctacctttgca
gcaggggctgctgctgctgcggctgcagaggtgaaacaagaagctgacaaaagtgcagct
gttgcaaccgttgttgctgctgttgatatggccagagtgagagaaccagttatcagtgct
gtagagcagactgctcagaggacaaccacgactgctgtgcgcatccaacctgctcaagaa
cagataaaaaaggaggcagagaagactgctgtaactaaggtggtagtggccgccgataaa
gcaaaagaacaagaattgaaagcaagaaccagagaagtaataaccacagaacaagagcag
gtgcacataactcatgaacagataagaaaagaaactgaaaaggcatttgtaccaaaagta
gtaatttccgcagctaaagccaaagaacgagaaactagaataaccggagaaattactaca
aaacaagaacaaaaacaaataacacaagaaacgataatgaaagaaactaggaaaacagtt
gtacctaaagtcatagttcccatgcccaaagtcaaagaacaagatttagtatcaagaact
agagaagacatcactgccaaaagagagcaagttcaaataactcaggaaaagatgagaaag
gaagctgagaaaactgccttgtctgcaatagcagttgcaactgctaaagccaaagaacaa
gaaacaatactgagaactagagaagaaatggctgctagacaagaacaaatccaagttact
catggaaaggtgggcgttgaggaaaaggcggaagctgtagcaacagtggttgctgcagta
gaccaggcccgagttcgagagcccagagaacccggacatgttgaagaaatgtatgctcag
aagaccactttggagtatgagttcaaggagcatgtttctgccgcaaaggtagctgagcat
ccgccacgtccagcctcagaaccccacattgtccctaaagcagtcaagcctggagtgatc
cacgctccttctgagactcatatcacaactacggatcaaatgggaatacacatatcatca
cagatcaagaaaactacagatctgacaagtgaaagattagtccatgtggataaacgcccc
cgcacagcaagccctcattttaccgtttcaaaaatttctgttcctaagccagaacatgga
tatgaggcatcaatagccggtagcgctattgccacgttacaaaaagagttctcagccaca
ccttctgctcagaaggtcaccaaatccgtgaaggcacctactgtgaagcccgctgaggct
agagtgagagcagagcccaccccttcaccccaggtcccctttgtggacacaccagagact
tttaagagtcaagctgacattgaggtggagaaagaagtcggggtgagcatcgctggtggc
gcagtccgtgaagagcacttcgaagtactgcacgagcgtgaagccaaggtaacagaaaca
gcaaggatacctgcacctgttgaaatccctgttactccaccaactttagtctcgggctta
aagaacgtgactgttattgaaggtgaatctgtcaccttcgagtgccacatctctggatac
ccatccccaaaagtgacatggtacagggaagactaccagatagaaagctccattgatttc
cagataaccttccagagtggaattgctcgtcttatgattcgtgaagcctttgcagaagac
agtgggcgatttacttgcagtgctgtgaacgaggctggaaccgtcagcacatcctgctat
ctagctgtgcaagtgtcagaagagtttgaaaaggaaacagctgtggctgaaaaaattacc
acagaagagaaacgctttgtcgaagcaagggacgtgataatgacagatactagcatcaca
gaggaaccagcagggcctggagaacctgccgctcctttctttattacaaaaccagtggta
cagaaactggtagaaggcgggagcattgtatttgaatgccaggttgacggtaacccaaag
ccccacgtctactggaagaagtccggtgttcctctaaccactggatacagatacaaagtg
agttacaacaaacaaactggcgagtgcaaactggtgatttcgatgatgtttgccgatgat
gctggagaatacactattgttattcgtaataagcatggagaaacttctgcatctgcctcc
ttgcttgaagaagctgattatgagtcactgatgaagtcccagcaagaaatgctttaccag
acacaaatgactgcatttgtgcaagaacctaaagttggagaaatagcacctggatatgta
tactctgaatatgaaaaagagtatgaaaaagaacaagcgttaattaggaagaaaatggcc
aaagatactgtaatggtcagaacttttgtggaagaccaggaattccatatttcttccttt
gaagagagacttattaaagaaattgaatacagaataataaagactacattagaagaactt
cttgaagaagacggagaagaaaagatggcagttgacatttctgaatctgaagctgttgaa
gcaggatttgatttaagagtcaagaattacagaatttttgaagggatgggtgttactttt
cattgcaagatgtctgggtatccattacccaagattgcatggtacaaagatggcaagcgc
atcagacatggagagagataccatatggactttctacaagatggcagagctagtctgcgg
atacctgttgttcttccagaagatgaaggcatctataccgcgtttgccagcaatattaaa
ggaaatgcaatttgctcagggaaattgtatgtggagcccgctgcaccacttagtgctccg
acttacatacccacaccagagccagtgagcagaatcagatccatctctccacgttcagtg
agcagatctccgatacgcatgtcccctgcacggatgtcccctctacggatgtcccctgca
cggatgtcccctggacgtaggctggaggaaacagatgagtcacagcttgagagactgtat
aagccagtctttgtgttgaaacctacttctttcaaatgtttagaaggacagactgccaga
tttgacttaaaggtcgtgggtcgacctatgccagagaccttctggtttcatgacggtcag
aaaattgtcaatgactatacccataaagtagtcattaaagaagatggtacccaatcacta
attattgtccctgcaacacccagtgattctggagaatggactgtggttgcccaaaacagg
gcgggaaaatcatcaatttcagtgattttaaccgtggaagctgtggaacatcaggtaaaa
ccagtgtttgtggaaaaactgaaaaatctcaacataaaggaaggttcccgacttgaaatg
aaagtcagagctacgggtaaccccaaccctgacatcatatggttgaaaaacagtgagatc
attgtacctcataaatatccaaaaatcagaattgaaggaaccaagggagaagctgccctt
aaaattgactccactgtcagccaagactctgcctggtacacggcaactgccattaataag
gctggccgagacactacaagatgcaaagtaaatgttgaagttgagtttgcagagcctgag
ccagagagaaaattaatcatcccacgagggacatatagagcaaaggagattgcagcccca
gagctggagcccctccatttacgatacggtcaagagcaatgggaagagggtgacctctat
gacaaagagaaacaacagaaaccatttttcaagaaaaaactcacttccttaagactcaag
cgctttgggcctgcccactttgaatgcaggctaacaccaattggtgacccaacgatggtg
gtggaatggctccatgatggaaagccgctggaagctgccaacaggctccgtatgatcaat
gaatttgggtattgcagccttgattatggagttgcatattccagagacagtggtatcatt
acctgcagagctactaacaaatacggaacagatcacacatctgctacccttattgtcaaa
gatgagaagagtctcgtggaagaatctcaattgcctgaggggaggaaaggcttacagaga
attgaagaattagagcggatggctcatgaaggtgcccttacaagtgtgacaaccgatcaa
aaagagaagcaaaagccagacatcgtcttgttcccagagccagcaagagtacttgaaggg
gagaccgccagattccgttgccgagtgacaggctaccctcagcccaaagtcaactggtac
ctcaatgggcagctcatccgcaaaagcaaaagattcagagttcgctatgatggcattcat
tatctggacatcgtggactgcaaatcatatgatacaggtgaagtcaaggtcactgcagaa
aaccctgaaggtgtgatagagcataaagtgaagcttgagatccaacagagggaagatttt
aggtctgtccttaggcgagcccctgagccaaagcctgagtttcacgtacatgaaccggga
aaacttcagttcgaagtacaaaaggtagacagaccttctgacaccactgaaactaaggaa
gttgtgaggttgaaaaggactgaaagaattacccatgaaaaagtgtctgaagagtcagaa
gagctgcgtagtaagttcaagcgcaggactgaggaaggctattatgaagccattactgct
gtggagctcaagtctcgtaagaaggatgaatcctatgaagaacttctaaggaagacaaaa
gatgaacttctccactggaccaaagagttaactgaagaggagaagaaagcccttgccgaa
gaaggcaaaatcactattccaacttttaaacctgataaaattgaactaagtcctagtatg
gaggctcctaaaatctttgaaagaatccaaagccaaacagtgggccacggatctgatgta
cacttccgggtcagagtggtggggaaaccagatcctgaatgtgagtggtacaaaaacggt
gtaaagattgagcgctctgaccgaatctactggtactggcctgaagacaatgtgtgtgag
ctggtcataagagatgtgacggctgaggactctgccagcatcatggtaaaagccatcaat
atagctggggagacctcaagtcacgcattcttactcgtccaggccaagcaattgatcact
ttcacacaggaattacaagatgttgttgctaaggaaaaagacaccatggcaacatttgaa
tgtgaaacctcagagccatttgtcaaagtgaaatggtataaggatggcgtggaggttcac
acgggagataaatataggatgctctctgacaggaaagttcacttcctctccgtcctgaca
gtcgacacatctgatgctgaagactatagctgtgtacttgtggaagatgaaaacgtaaaa
acaacggctaaacttattgtcgaaggtgcagtcattgagtttgtgaaagaacttcaggac
atagaagttccagaatcattttcaggagagttagagtgcattataaccccggaaaatata
gaaggcaaatggtatcataatgatgtggagcttaaatccaatggcaagtacacgattaca
tctcgccgtggacgtcagaacctcacagtcaaggacgtgaccaaagaggaccagggagaa
tacagctttgttgtcgacgggaaaaagacaacctgtaaactaaagatgaaaccccaccct
gttgctatcctacaaggactcagtgatcaaaaagtctgcgagggtgacattgttcagctt
gaagttaaagtctccttagagaatgtggaaggtgtctggatgaaggatggcgaagaagtg
cagcctggcgacagggttcacattgtgatagacaagcagtcacacatgctgcttattgaa
gacatgactaaggaggatgctggacattactccttcaccattcctgcccttggactgtca
accagtgggcgcgtctctgtctacagtgttgatgtgataacacctctaaaagacattaac
gtgcttgagggcacaaaggctgtgctcgaatgtaagatctcagtccctgatgtgacttct
gttaagtggtacttaaatgatgaacaaatcaagcctgatgatcgcgtgcatgccattgtc
aaaggcactaagcagcgacttgtgattaaccggacctatgcttcagatgaaggtccttac
aagctgatggttggcagagttgaaaccagctgtgatctttctgtagaaaaaattaaaatt
atcagaggtcttcatgaccttacctgtacagagacccaaaatgtggtcttggaagttgaa
ctgtcccactcaggaattgatgtcttatggaattttaaggacaaggaaatcaaacccagt
tctaaatataaaattgaagctcgtgaaaaaatatataagttgacggttctaaatatgatg
aaagatgatgaaggggaatatacattttatgctggagaaaatatgacatctggaaaactt
accgtggcagggggtgccatctctaagccactcacagatcagactgtagctgaatcccag
gaagctgtgtttgaatgtgaagttgccaacccagattccgaaggagaatggttgaaggat
ggcaaacacctaccgctgagtaaaaacatcagaagtaaatctgatggccacaaaaggagg
cttatcattgctgccaccaaactagatgacattggagaatacacctacaaggtggccact
tccaaaacatctgccaaacttaaagttgaagctgtcaaaattaagaagactctgaagaac
ctcacggtgacagagacgcaagatgctgttttcactgtggagctcacacaccctaatgta
aaaggtgtccagtggatcagaaacggggttgtgctggaatccaatgacaagtacactgtc
tcagtcaaaggaacaatttactctctgagaattaaaaactgtgccgttgtggatgaatct
gtttatggcttcaagcttggaaggctgggagccagtgccagactgcacgttgagactgtc
aaaatcattaagaagccaaaggatgtaactgccttggaaaatgccaccattgcctttgaa
gttagcgtttcccacgacacagtgccagtgaaatggttccacaagaatgtggagattaag
ccgagtgacaaacacaggctggtctcagaaaggaaggtccacaaactgatgctgcagcat
atttcccccttggactctggggaatatacagctgtggtggggcaattggaatgcaaagca
aaactattcgtggagacattacatattacaaaaaccatgaaaaacattgaggtacctgag
accaaaactgcctcctttgagtgtgaggtctcccacttcaatgtgccttccatgtggctc
aagaatggggtggagattgaaatgagtgaaaagttcaagatcgtggtgcagggaaaactc
caccagctgatcatcatgaacaccagcacggaggactcagcagaatacacatttgtctgt
ggcaatgaccaagtcagcgccaccctgaaagtgaccccaatcatgattacatccatgctg
aaggacatcaatgctgaagaaaaagacaccattacctttgaggtaacagtgaactatgaa
ggcatctcttacaaatggttaaagaatggcgtggaaatcaaatcaactgacaggtgccag
atgagaaccaaaaagctcacacactcactgaacatcaggaatgttcactttggggatgct
gctgaatacacctttgtggctggaaaagcaacctcgacagccactctttacgtggaagct
cgtcatatagaatttaggaaacacattaaagacattaaggttctcgagaagaggcgagcc
atgtttgaatgtgaagtttctgaacctgacatcactgtgcagtggatgaaagatggccaa
gagctacagcttgtggacagagtaaagatacagaaggagaaatatgtccaccgccttctg
atcccatccacccggatgtctgatgctgggaagtacacagtggtggctggaggcaacatg
tccactgccagcctctttgtagagggcagagacgttcgcatccgaagcattaaaagggag
gttcaggttattgagaaacaacgtgctgtcgttgagtttgaggtcaatgaagatgatgta
gatgcccactggtataaagacggcattgaaatcaatttccaagttcaagaacgacaccag
tatgtggtggagagaagaatccaccggatgtttatctctgagaccaggcatagcgatgct
ggtgaatacacctttgtggcaggaaggaacaggagttctgttaccctctacgtcaatgcc
ccagaaccgccccaaattctgcaggagctccagcctgttaccgtgcaatctggcaagccc
gcccgcttctgtgctgtgatatctggcagaccacagcccaaaatttcctggtacaaggaa
gagcagctgctttccactggtttcaagtgcaagttccttcacgatgggcaagagtacaca
cttctgctcatcgaagccttcccagaggacgcggccgtctatacctgtgaagccaagaat
gactatggaattgtcactacctcggcatcgctctctgtggaagttccagaagttgtgtct
cctgatcaggaaatgccagtttatcctcctgccatcgtcaccccacttcaggacactgtc
acttctgagggacggccagcccactttcaatgcagagtttctggaacagatctaaaagtg
tcttggtacagcaaagacaagaaaatcaagccatctcggttctttaaaatgactcaattt
gaagacacttaccaactggaaattgctgaagcttttccagaagatgaaggaatttatact
ttcgttgctagtaatgctgtaggtcaagtatcaagcacagccactttgagactggaagct
cctgaatcaatgttgcatgagcagattgagatggagatgaaagagttggcttctcttctg
tctgctgaggaagaaggacctcaaacctctagctctggccttcagttatctaatagaaat
gaaacagttgaacttttgtctgaacctccagttcattcaactaaattcgattccaaagag
gaaggcagtgtcccagttttcatcaaagaagtgtcaaatgctgacataagcataggggat
gtggctaagttgtctgttactgtcattggtattcccaagccccagattcagtggttcttt
aatggagtcatgttaaccccttcagctgactacaaatttgtttttgacagtaatgattac
agcttgatcattctgttcaccaaattagaggatgagggagagtatacatgtattgccagt
aatgaatacggacaggcgatatgtagtgcctatctgaaaataaattccaaaggagagggg
ctccaagaaccagaatcagcagaagagaaatctctggaaaagctcgaaggtccttgtcct
ccttacttccttaaagagttaaaagcagttcactgtgcacaggggctccctgccatcttt
gagtacacagtgcttggagagcctgcacccactgttttgtggttcaaagaaaacaagcag
ctttgcaccaatgtttattacactatcattcataatcctgatggttccgggacattcatc
gtcaatgaccctcagaaagaagacagtggtttctatgtctgtaaagcggagaatgtgtgg
ggtgaatccacctgtgccgcagagctgctcgtgtttctggaagacacacacaagactgat
gccccctgtaaagcaacgtccacgccagaggctcctgaagattttccccagacgtcgtta
acggtccctgcagttgaggcacttgactcagaacaggaaacttcagcttttgtaaaggac
accattttgaaagctgctttaattgcagaaggaaaacagcagctttcttatgagcatatt
gttaaaaccaatgaactgagcagtcaagttactttaatagctgagcaattgcaatccaca
ctcatgttagagcaggatatgcccactcctgaaagcatcggtgaacgtctttccatcagt
gacactattcatgtccagcctatcaaggaaccacctcccaatgtagagctgcagattgtc
cagtcccaggacaccgtctccaaagaagatattctaatgtatcaagaggctgaattacag
gtggttctatcagatactgaaaaaatcttcccaagtgccatgtccatagaggaaattagt
tcattaagagttgagtctctgcaaacttttttagctgaacctgaagggagttatccgcag
tcatcaatagaagaaacgccagcccattcatatccaacctctgtggctgaggaagtactt
ttaccaaaagaaaagatagtatccgcagtgggcgaagagcaaagagtgatccttcaaaag
caagaggtgcaaagtgctctcatcctgaatcagagcttagctgagggacacgtggaaagt
tcccagggtcctgacatcatgatctcccgggttccttcagaacacacgtgcacagaaggt
gaaatcttaatggaaagtgtggatcaacttgacagcgcaaagcaagatttcgcagccagc
gttgaggaaggcaagtccttaaggtttccattagcaggtgaggagaagcaggtactgctc
aaggaagagcgttctgacagcttggcaatgcccccgaaccaaaccactgagtataaaaaa
gagcccatggcaataagtggtgtgcaggaggtgcagggaagtgaccttctttctaaggaa
agtttgctttctggtattcctgaagagcagcggttaaacctgaaaactcagatccgcagg
gcttggcaagcagcagtggccagcgagcagctgagtctcttctctgaatggttaagaaac
attgcacaggtagaggtcaaggccatagacttcagccgagagcccaactgcattatgtgc
acctactttattacctcagtgaagtctctaacagaagaattaaccatcactattgaaggc
attgatcctcaaatgactaacttgaaaactgaacttaaggaggctttgtgctctataata
tgtgaggaaatgaacatcttaacagctgagaaacctggaattcagaaaggagccacaata
gacttgcaggaagaaatggattctttttctaatccacaaaaggttgaagcaatcaccgaa
ccagaggttgaatctaaatatcttgtcttaaaggaagagataagttattttaaggtgaaa
agtcaggtcaaagctgtgggtgccacagctgcttccgctgctgtctctgatgaaaaactg
gatgagataccaaaaccatcagaggaaaaagagaaatcctctgaaggtggtactgagaag
tctggtacagtagagatacgggaggctgagggtagctcactcagagagggtggccctgat
gtacagacgcccttggtggacacgattgccaaggaaggtgacaccgtaagcctcgcgtca
tccataacaaatgccaaacaggtgaattggtattttgagagtaaactggtgccttcagat
gaaaagttcaggagtttacaagataaaaatacatatatgctagtgatcgacaaagtaaat
agagaagaacatcaaggggaatatatgtgtgagaccttgaatgacgacagaaaagcagca
acttcagcaaaactcactgtagtcaaaagagctgccccagtgatcaggaggagaattgag
cccctggaagtagccctgggccacctcgccaaattcacctgtgagatccacagcgccccc
aatgtccgcttccagtggttcaaagctggccgagaaatctatgagagtgacaagtgttct
attcggtctgcaaattatgtctccaccctggaaatcctgagaacccaggttgttgactgt
ggcgagtacacctgcaaagcttccaacgagtatggcagtatcagctgcacagccgccctg
actgtgacagaggcatatccaccagcctttctctccagacctaagtccataacgactttt
gtgggtaaggcagccaagttcctctgcacagtgacagggactcccgtgattgaaaccatt
tggcagaaagatggtgtggccctctcaccttcccctaactgcaggatttcagatgcaaac
aacaaacacattttagaactctcaaatcttacaattcaagagagaggagtttactcctgt
aaggcttccaacaagtttggagccgacacttgccaagccgagttggtcataatcgataaa
ccacatttcattaaagaactagagcctgtgcaatcagctgtcaataagagggtacacctt
gagtgccaagtagatgaagacagaaaagtcacagttacatggagtaaaaacgggcaaaag
ctcccccctgggaaagattataagatctgttttgaagataaaatagcatcactcgagatc
cctctggccaaactaaaagatacaggaacgtatgtttgcacagcttccaatgaggctgga
agcagctcctcttcagcgacagtaactatcagagagccaccatcctttgtgaagaaggtg
gatccctcttatttaatgctcccaggtgaatcagcacgcctccactgcaagctgaaaggc
tcacctgtgatccaggttacttggtttaaaaataacaaagaacttactgagagtaacaca
atcagaatgtcttttgtcaattctgaggctgtccttgatattacggatgtaaaagttgaa
gacagtgggaattactcatgtgaagcagtgaatgacgttggcagtgacagttgcagtgcc
gaaatagttatcaaagaacctccttctttcatcaaaactctcgagcctgcagatatagtg
agaggaacaaatgccctccttcagtgtgaaatctcaggcactggaccatttgaaattcgc
tggttcaaggataagaagcaaattcgaagtagtaaaaagtacaggttgttttctcagaag
tctgtcgtgtccctggaggtcttttcatttaatagggcggatgttggtgaatatgaatgt
gtggttgctaatgaagttgggaagtgtggctgccttgcaacccacttactaaaagaacca
ccaatctttgtaaagaaagtagatgattttactgcactagcaggacaaacggctacctta
caagctgctgtgaaagggtcagaacccatttctgtcacatggatgaaaggacagaagatc
attaaagaagatggaaaaatcaaaatgagctttgtcaatggtgttgcggtcttgataatc
cctgatgtgcagattagttttgctgacaaatacacatgcctggctgaaaatgaagctgga
agccaaacgtctgttggggaactaatagttaaagaacctgccaaaatcgttgagagagca
gaactgatccaggtgacagcaggagacccagccacgctggagtatactgtcacgggtacc
ccagaactcaagcctaaatggtacaaagacgggagacctttgattgccagtaaaaagtat
cgaataagttttaaaaacaatgttgcccaactcaagttttactctgccgaactgcatgat
agcggccaatacacatttgagatttccaacgaagtgggcagcagctcctgtgagacaact
ttcactgtcttagatcgagacattgctccattttttaccaaacccctacgcaacgtggac
agtgtggttagtgggacctgcaggctggactgcaaaatcgctggctccctccccatgagg
gtgtcctggtttaaggatggtaaagaaatagcttcctctgacagatacagaatagcattt
gtggaaggcacagcctctttggagataagcaggatagacatgaatgatgcagggaatttc
acctgtcgagccacaaattccatgggaagcaaagactgcagcggagccctgattgtgcaa
gaaccacctagttttgtaactaaaccggcatcaaaggatgttctgcctggctcgaccatc
tgcctgaagagcaccttccaagggtctacccctctcacaatcagatggtttaaaggtgac
aaagagctggtttccggtggaaactgctatatcaccaaagaagctttagaaagttccctg
gaactctatgtagtaaaaacctccgactcaggcacatatacctgtaaagtcagcaacgtg
gctggagccgtggagtgcagtgcaaagttatttgtaaaagaacctgccacatttgttgaa
aagttagagccatcacagctgttaaaaaagggagatgccacccagctagcctgcaaagta
acgggcacccctccaattaaaataacgtggtttgcaaatgaccgagaaattaaggagagc
agcaaacacaaaatatcttttgtggagtccaccgcggttctaacacttaaagatgttgcc
gttgacgacagtggtgaatatatgtgtgaggctcaaaatgaggctggcagtgaccactgt
ggtagcattttaatagtcaaagagtcaccttactttaccaaggaatttaagcccattgaa
gtgttgaaggagtatgatgtcatgttgctggctgaggtggcaggcacacctccctttgag
atcacttggttcaaagacaacacaacactgcgaagtggtagaaagtataaaaccttcatt
caggatcagctggttagcctgcagatcctcaggtttgtagctgcggacgtgggtgaatac
cagtgtcgggtgaccaacgaggtgggcagcagctcctgcagtgccaaggtgactttaaga
gaacccccagcttttgtaaagaagatcgagagcaccagctcccttagaggaggtaccgct
gccttccaggccactctgaagggatccttgccaatcacggtgacttggctaaaagacaac
gatgaaatcactgaagatgataacataagaatgacctttgagaacaatgtggccagtctg
tacctcagtggcattgaaatcaagcatgatgggaaatatgtctgtcaggccaaaaatgat
gcaggagtacagagatgttccgcattactctcagtaaaagaacctgcaacaatcattgag
gaggctgtgtctatagatgtcacccaaagagacccagccactttgcaggttaaattttca
gggactaaggagattacagccaaatggtttaaagatggccaagaactgaccctgggccaa
aaatataaaatcagtgtcactgacacggtctctatactgaagattatttctacagaaaag
agagatagtggagaatatactttcgaagtccaaaatgatgtcgggaggagcagctgcaag
gctcgcattaatgtattagatcttatcatacctccctcatttgccaaaaagctgaagaaa
atggacagcattaaagggtcttctattgacttagaatgtatagtggctgggtcacatccc
atgagcatccagtggttcaaagacgaccaagaaataacagctagtgaaaaatacaaattc
tcttttcatgacaatactgccttcttggaaatcagtcagctggaaggtacagacagtgga
acttacacttgttctgccactaataaggcaggacacaaccagtgcagcggccatctgaca
gtcaaagaacccccttacttcctggaaaagccacagtcacaagatgtcaatcccaataca
agggttcaattaaaggcgcttgtgggtggcactgcacccatgacaataaaatggtttaaa
gataacaaagagttgcactcgggagcagctcgctcagtttggaaggatgacacctccacc
attctagagctcttttcagccaaagctgccgatttggggacctacatttgccaactgagc
aacgatgttggcacagcaaccagtaaagccactctctttgtaaaagagcctcctcacttc
attaagaagcccagcccagtcctagtgctgaggaacggacaatccacaacatttgaatgt
caaataacaggcactcctgaaatcacagtttcttggtatctggacgggaatgaaataaca
gccattgagaaacatggcatttccttcactgacggtttagccactttccaaatttctggt
gccagggtagaacatagtgggacttatgtctgtgaagctcgtaacgacgctggcacggca
agctgcagcattgagttaaaagtgaaagaacctcccaccgttatcagggagctgaaaccc
atggaagtagtcaaagatagtgacgtggagctggagtgtgaagttatgggaacatctcca
tttgaagtcacttggctgaagaataacaaggaaattcgaagcagcaaaaagtatacgctg
actgacagagtgtcagtgtttaatctcaatatcaacaagtgtgacccctcagacactgga
gaataccagtgcatcatatccaacgaaggcggcagctgttcttgtagtgctagagtctct
ctgaaagagccacccttgttcacgaagaagatagaaaacgtcactactgttttgaaaagt
tctgccacctttcagagcactgtgacgggctctcctcccatttttataacctggctcaag
gatgatcagattctggatgaagatgataatgttcacatctcctttgtgaacaatgtggcc
acagttcaaatcagatctgtggataatggacacagcgggaggtacacgtgtcaagccaag
aacgagtcaggagttgagaggtgttatgctttccttttagtacaagaacccgctcagatc
ctagagaaacctaagtctgttgatgtcactgaaaaagacccagtgaccttggagtgtctt
gtggctggaacgccagaactcacagtgaagtggtttaaagatgggaaacaaatggtgccc
agtagatattgttcaatgagttttgaaaataacgtggccagttttaggattcagtcagta
atgaagcaagacagcgggacatatactttcaaggtggaaaatgactttggaagcagtagc
tgtgatgcctacctgagagtgctagatcaaaatattcctccatcattcaccaaaaaatta
agcaaaatggataaagttctaggctcttccattcatatggagtgcaaggtttctggctca
cttcctattagtgctcagtggtttaaggatggaaaagaaataactacaagtgcaaaatac
aggctcgtctgtcatgaaaacactgtgtcgctggacgttagtaatctggaattagaagat
acggcgaattacacatgcaaagtctcaaatgtagcagggggcgaggcatgcagtggcatc
ttaactgtaaaagaaccaccaagtttcctagtgaaacctgagcgacaacaagccatacct
gattctacagtggaatttaaagctatactaaaaggaacaccaccgtttaaagtaaagtgg
tttaaggatgatgtggaacttgcctctggacctaaatatttcattggcttggaaggatca
actaccttcttaaatctctattcagtggatgcttccaagactggacagtatacttgccaa
gttaccaacgatgttggtagtgactcttgtaccacagtgttgcttgtgacagaaccacca
aagtttgcaaagaaactagaagcaaccaaaatagtgaaagcaggtgactcagcacgactt
gaatgcaagataactggatccccagacatcagagttgtgtggtacagaaatgaacatgaa
ctcccagccagtgataaatacagaatggctttcattgactcagtggccgtcatacagatg
aatagtcttggtactgaggacagtggggatttcatttgtgaggctcagaaccctgccggc
agcacaagctgcagtaccaaggttatagtaaaagaaccacctgtttttagcagcttccct
cctgtggtagaaacccttaaaaatgctgaagttagtcttgaatgtgaacttttgggaaca
ccaccatttcaggtggtttggtacaaagataagcgacaactccgaagtagcaagaaatac
aagatcgcatccaaaaatttccatgcaagtattcacattctcagtgtcaacacttcagat
attggtgaataccactgcaaagcacagaatgaagtaggaagtgatacttgcatttgtact
gtaaaattaaaagaaccaccaagatttgtctccaaactgaacagcctcacggttgtagct
ggtgagcccgctgagttacaggcatccatagaaggcacccagcctatttctgtccagtgg
cttaaagaaaaggaagaagtgattagagaaagtgaaaacatcagaattacatttgtggaa
aatgttgcaactctgcagtttgcaaaagcagagccagctaatgctgggaagtatatctgc
caaatcaggaatgatggtggaatgagggagaacatggccacgttgactgttttagagcct
gcggttattgtcgagaaggcaggttcgatgacagtgactgcaggagaaacgtgcactctg
gagtgtaaggtggctggcactcctgaactctcagtcgaatggtacaaggatggaaagctg
ttgaccagcagccaaaaacacaaatttagcttctacaacaaaatctcttccttaaagatt
ctctccgttgaaaagcaagatgcaggcacatacactttccaggttcaaaataatgttgga
aaaagcagctgcacagctgtgcttgatgtttcagaccgaatggttcctccctctttcaca
cgaagactgaaagatacagttggggtgctggatacatcttgcatcttggagtgcaaagta
gctggatcatcgcctatctctgttgcctggtttcatgagaaaaccaagattgtcagtgga
gcaaagtaccaaactacgttttcagataatgtctgtgcattgcagctgaattctctggac
tcatcggacatgggcaattacacatgcatcgctgctaatgtcgctgggtctgatgaatgc
cgtgctgtgttggctgtacaagaaccaccctcttttgtgaaggaacctgaacctttggaa
gtactaccaggcaaaaacatcaccttcacaagtgtcattagaggaacacctccattcaag
gttggctggttcagaggagccagagaactggtgaaaggagaccgatgtaacatctatttt
gaagacactgtggcagaactggaattatttaatgtcgacatatctcagagtggggaatat
acctgtgtggtttctaacaatgccggccaaacatcctgcactacccgtctctttgtaaaa
gaaccagctgtatttgtgaagaaattaagtggtcactctgtagaaccagggaagtccatc
attctggagagcacctacactggaacactccccatttcagttacctggaaaaaggctggt
gtgaacattacaccatctgaaaaatgcaacatagttacaacagagaagacctgcatcctg
gaaattctgaatagcacaaaaggagatgcaggacagtattcttgcgagattgaaaacgag
gcaggaaaggatgtttgtgaagctctggtatctacattagaacccccttattttgttacg
gaactgaagcctctggaggcatcagttggagattcggtttctttacaatgccaagttgct
gggacaccagaagttacagtgtcttggtacaaaggcgataccaagttacggtcaactccg
gaatacaggacctattttacaaacaatgtggccacacttgtttttaataaagtgaacatc
aatgacagtggagagtacacatgtaaagcagaaaacagtatagggactgcttcttctaag
actgtcttcagaattcaagagcgccagctcccaccttcctttgcaaggcagttaaaggat
atcgaacaaactgttgggttaccagttaccctcacttgtcgactgaatggctccgcaccc
atccaagtgtgctggtatagagatggggtacttttacgagatgatgaaaatctacagaca
tcatttgtagataatgtggcaactttaaaaattttgcaaacagacttgagtcactctggc
caatactcctgctcagcttctaattcacttggaacagcgtcttccagtgctagactgaca
gcaagagaacctaagaaatctcccttctttgacatcaagcctgtatctatagatgttatt
gctggggaaagtgctgactttgagtgtcatgttactggtgctcaaccaatgcgaattact
tggtcaaaagataacaaggaaatccgtcctggaggaaactacacaattacatgtgtggga
aacactccccatttgagaattcttaaagtaggcaaaggagactctggtcaatatacttgc
caagcaaccaacgatgttggcaaagacatgtgctcagctcaactcagtgtaaaagaacct
ccaaagtttgttaagaaattagaagcttcaaaagttgcaaagcagggagaatccatcaaa
ctggaatgtaaaataagcggttccccggaaatcaaagttttgtggttccgaaatgacggt
gaacttcatgaaagttggaaatacaacatgtcattcgtggattctgtggcatcgctcacc
atcaatgaagccagcacagaggatagtggggactatatctgtgaagcccataacggtgtc
ggggacgccagctgcagcacagccctgacgattaaagcacctcctgttttcacccagaag
ccttctccagtaggagcccttaaaggttctgacgttatcttccaatgtgaaatttcggga
acacccccatttgaagtagtgtgggttaaagatcgaaagcaagttcggagcagcaagaaa
tttaaaatcacttcgaaaaattttgatacaagtctccacatccttaatctggaagccgct
gatgtaggagaatatcactgcaaagctgctaatgaggtgggaagtgacacgtgtgtttgc
actgtcaagttcaaagaacccccacggtttgtgaagaagctaagtgacacctcaaccctc
gctggggatgccgttgagttacaggccgtagtggaaggcttccagcccattgctgtcatc
tggctgaaagataaaggtgacatcatcagagagagtgaaaacactaggatttcattcatt
gataacgttgcaacactccaacttgggagcccagaagcatctaactctggaaaatatgtg
tgccagatcagaaacgatgccggaatgagagagtgttcagcagtcttgactgtcctagaa
ccagccagaatcatagagaaaccagaacccatgactgtcactactggaaatccttttgca
ttagagtgtgcagtggctgggacaccagaactttcagccaagtggttcaaagatgggaga
gaattatctgcagacagcaaacatcacatcacgttcatcaacaaagtggcttcacttaaa
atcccttgtgcagaaatgagtgacaaggggttatatagctttgaagtgaaaaacagtgtt
ggtaaaagtaactgcactgtgtctgtccacatttcggatcgagttgtgcctccttccttc
atccgcaagttgaagcacaccaacgctgtcctgggggcctcggcggttttggagtgcaga
gtctctggctccgcgcccatctccgtgggctggtttcaggatggaaatgagatcgttagt
gggcctaaatgccagtccagcttttcggaaaacgtctgtactttgaatctgagcttcttg
gagccctccgacacaggcacatacacatgcgtggccgccaacgtggctgggtcagacgaa
tgctcggccgtcctgactgtccaagaaccaccatcttttgaacaaacccctgattctttg
gaagttctccctggaatgagcctcacattcaccagtgtcattagaggcaccccgcctttc
aaggtcaaatggtttaaaggcagcagggaactggtgtcaggggagtcatgcagcatctct
ttggaagattttgtcacagaactggaattgtttgaggtggagccattgcaaagcggggac
tattcttgcctcgtggctaacgacgctggcagtgcttcctgtaccacgcatctttttgtg
aaagaaccagccacctttgtgaaaagattggctgacttcagcgtcgagacaggaaacccc
atcgttctcgaggccacgtttactggcacacctcccatctcagtgagctggatgaagaat
gagttcccccttacacaatctcggaattgcagcattaccatgacggaaaaatctacgatc
ctggaaattcttgatagcacaatagaggattatgcacagtacagttgcctcatagaaaat
gaggccggtcaagatatttgtgaagcgctggtatctgtcttagaaccaccttattttatt
gagcctctggaacacatggaagtggccgtcggagaacctgtaactttacagtgtaaagtg
gatggaaccccagaaattagaatttcttggtataaagaacacacaaagctacgatcggct
cctgcgtataaaatgcaattcagaaataatgttgcctccttagtaatcaacaaagtggat
cccagtgacatgggagaatacacgtgcaaagccgaaaacagtgtgggggcagtggcttcc
tcagctgtgctcgttatcaaagagcgcaaacttccaccttcctttgcaagaaaactgaag
gatgttcaggagacccttggcttcccagttgcatttgaatgtcgcatcaatggctcagaa
cctcttcaagtgtcttggtacaaagatggggtacttttgaaagacgatgctaatttgcaa
acatcttttgttcataatgtagcaactcttcagattttgcaaactgaccagagccatgtt
ggtcagtacaattgctcggcttctaatcctcttgggacagcttcatccagtgcgaagctc
atcctcttagaccatgaaatacctcctttctttgatctaaagcctgtgtcagtagatctt
gctcttggagaaagtggttcttttaaatgtcacataactggaactgcaccaatcaagatc
acttgggccaaagataaccgagagattcgccctggaggcaactacaagatgactttggtt
gaaaatactgccactctgacggttctcaaagtaggcaaaggcgatgctgggcaatacacc
tgctatgcaagcaacgtcgctggaaaagactcttgttctgctcatctgggtgtacaagaa
ccccccaggttcattaagaagctagaaccttcaagaatcatgaaacaagatgaatctaca
agatatgaatgtaaagtaggagggtctccagaaatcaaagttttatggtataaggacgag
actgaaattcaagagagcagtaaattcagaatgtcattccttgactcggtggtggtattg
gaaatacactctctcagtgtggaagacagcggagactacacgtgcgaggcccgcaatgca
gcaggcagggcaagcagcagcacctccttaaaagttaaagaaccacccgttttccgcaaa
aagcctcatccagttgagacactggaaggagctgatgttcaccttgaatgtgagcttcag
ggcacccccccgtttcaagtttcttggcataaagacaagagagaacttaggagtggcaag
aagtacaagataatgtctgagaacttcctgacgagtattcacatcctgagcgtcagtgct
gcagacgttggggagtatcactgtaaagccacgaacgacgtggggggtgacacctgtgtt
ggttccatcactctgaaagcaccaccaagatttgtgaagaagcccagtgacatttctacc
atcgttggtgaagaagttcagcttcaggctgctattgaaggcactgagcccatttccgtg
gtgtggttcaaagacaagggggagatggtcagagaaagtgacaacatatggatctcttat
tcagaaaacattgcaaccctacggttttcaagagcggaaacagccaatgccgggaaatac
acctgtcagatcaaaaacgatgccggaatgcaagagtgcttcgccacagtgtccatcctc
gagcctgcagcaattgtggaaaagccagaatccataaaagtgaccacaggagacacctgt
accttggagtgcatggtcactggcacacccgaactcactactaagtggtttaaggatgca
aaagagctgacaagtgatagcaaatacaaaataagcttcttcaacaaactatctggcctt
aagattattaacgtggcccccagtgacagtggggtgtacagttttgaggtgcaaaaccct
gtgggcaaagacagctgcacagcctcagttcatgtttcagaccgaactattcctccttcg
ttcacaagaaaattgaaagagacaaatggtctgtctggttcctcagtggtaatggagtgt
aaagtctatggatcacctccaatctccgtctcctggttccatgaaggaaaccagatcagc
agtggaaggaagtaccagaccaccctgacggataacacttgtgccttaactgtgaacatg
ctggaagaatcggacgccggcgactacacatgtatagctactaatgtggctggttctgat
gagtgcagtgctcctttgactgtgagagaaccaccatcttttgttcagaaacctgatccc
gtggatgttttaactggaacaaatgtaactttcacaagccttgtaaaaggaacacccccg
ttcagtgtcagctggttcaagggtagcagtgaactagtaccaggggacagatgtaatgtg
tctttggaggattcagttgctgaactggagctgtttgatgtagatacatcacaaagtgga
gaatatacctgcatcgttagtaatgaagctggcaaagcttcttgtacaacacatctatat
gtaaaagccccagccaaatttgtgaagaagctcaatgattacagcctagagaaaggaaaa
tccctgatcctagagggcacatatactggaactcttcccatttcagttacatggaagaaa
aatggcataaatataactccttctcagaggtgtaatataaccacaactgaaaaatctgca
atcctggaaattccaagcagcacagtggaggatgcaggacagtacaactgctacattgaa
aacgcttccgggaaagactcctgttcagcacaaatcctgatactagaaccaccatatttt
gtcaagcagttggaacctgtgagggtgactattggagattctgcctctttgcaatgccaa
cttgctgggacccctgaaattggggtgtcctggtataaaggagatacgaaattgagaccc
acgactacctacaaaatgcattttaggaacaatgttgctacactggttttcaaccaggtt
gatagtaatgacagtggagaatatatctgcagggctgaaaacagtgtgggagaagtttct
tcatcaactttcctgactgttcaagaggaaaaacttccaccgtcgttttctcgacagttg
agagatgttcaagaaacggtcgggctgccagttgtttttgagtgtgctgtcagtggatca
gaacctattttggtgtcttggtttaaagatggcaagccattgaaagacggccccaatgta
caaacatcatttttagataatgtagccactctcaatatttttcaaacagatcggagtttt
gcaggccagtattcttgcacagctacaaatcctataggctctgcttcttccagtgccaga
ctcattctcacagaggggaagaacccacccttctttgacatccctcttgcccctgtggat
gctgtggtgggagacagtgcggactttgagtgccatgtgactgggacacaaccaataaag
ttcacctgggccaaagacaacagagagatccagagtggcggaaactatcagattagttat
ctggagaacagtgcccacctgacaatcctgaaagtacacaaaggagactctggacagtat
acgtgctatgctgtcaatgaagtgggagaggactcctgcatggctcagctcaatataaaa
gagcggctaattccaccaagtttcactaaaaaactctcggagacagtagaagaaacagaa
aggagctctttcaaactcgagggccttgttgctggttcccagcctatttctgtcgcttgg
tacaaaaataacgtagagatccatccaacgtctaactgtgaaatcacattcaagaacaac
acacttctgctgcaagtcaagaaggcaggcatggacgacgctggtttgtacacgtgcaaa
gtgtcgaatgatgcaggctctgctctgtgtacgtcttcagtcgtcatcaaagcacctaag
aagccacctgtgtttgatcagcaccctactccagtaacagttagtgaaggagaattcgtg
cagcttagctgccacgtccagggatcagaaccgatcaggatccagtggttgaaggctggc
agggaaataaagccctcagacagatgcaacttcagctttgctaatgggactgctgtgctg
gaactcaaggatgtggctaaagcagatgcgggagattatgtgtgtaaagcttcaaacgtg
gctggaagtgacacttgcaaatcaaaagtgaccgttaaagacaaaccagctgccatccca
gcagctaagaaagcagcagtagatggaaaactcttcttcatatcagaacctcagagtatg
agagttgtagaaaaaaccactgcaacattcattgcgaaagttggaggtgatccagttcca
gatgttaagtggacaaaagggaaatggagacaattgaaccaaggaggtcgaatttttatc
caccagaaaggcgatgaagcaaagctggagatcagaggcaccacaaaaactgattctgga
ttataccgatgtgtcgcatttaacaagcatggtgaaattgaaagtaatgttaatctacag
gtggatgaaaggaagcaacaagagaaaattgaaggagatcttagagcaatgctgaaaaag
actccagccttaaagaaaggagctggggaagaagaggaaattgatatcatggaacttctc
aaaaatattgatccaaaagaatatgaaaaatatgcccgcatgtatggaatcactgacttc
cggggtcttcttcaagcatttgaaatgctaaagcaaagtcaagtagaagagacacataga
ttggaaatagaggaaatagagaagtcagagaaggaagaaaaggaatttgaggaacttgta
tcatttattcagcaaaggctgtcacagacagagcctgtcactttgatcaaggacattgaa
aatcagacagttttgaaagataatgatgctgtgtttgaaattgacattaagattaattat
ccagaaatcaagctttcatggtacaaagggactgaaaaactggaacccagtgataaattt
gaaataagcattgatggtgatcaacatacactcagagtcaaaaactgtcaacttaaagat
cagggcaattatagattggtgtgtggtccacacatcgctagcgctaaactaactgtaatt
gagcccgcctgggaacggcatcttcaggatgttactttgaaagaaggccagacttgtacc
atgacttgccagttttctgtgccaaatgtaaaatccgactggttcagaaatggcagaatc
cttaaaccccaaggtagatataaaacagaagtggagcacaaagtccacaagctgaccatt
gcagatgttcgagcagaggaccagggtcagtacacctgcaaatacgaagaccttgaaact
tcagcagagctcggaattgaagctgaaccaattcagtttacgaagcgcatacagaacatt
gtggtgagtgagcatcagtctgccaccttcgagtgcgaagtgtccttcgatgatgccatt
gtaacgtggtacaaaggaccaacagaactgactgagagccagaaatacaacttcaggaat
gacggtcgctgccattatatgaccatccacaatgtgaccccagatgacgaaggtgtctat
tcagtaattgctcgactggagcccagaggtgaagcaagaagcacagcagagctgtactta
acaaccaaagaaatcaaacttgagatgaagcctcctgatattcctgactccagagttcca
attccaaccatgcctatcagagcagtaccaccagaagaaattcctcctacggcggttcct
cccatccccctgttgctaccatcacctgaagaaaagaaaccaccagcaaaacgtattgaa
gtgaccaaaaaagctgtgaagaaagatgctaaaaaagttgtcacaaagcccaaagaagag
gcaccaccgcccaaagttccagaggttgccaagaagcccccacctcctactgtcttaatt
ccagcagaagctcctgaaatgattgatgtatcctccaaggctgaagaagtgaaaataatg
accataaccagaaagaaagaggttcagaaagaaaaagaagctgtgtatgagaagaagcaa
gcggtctacgaggaggagaaagtttacatagaatctttggaagaaccttatgacgaacta
gaggtagaaccatacacggagccatatgaagaaccttactatgaggaaccagatgaagac
tatgaagagacccaggtagaagctaaaagggaagttcatgaggagtgggaagaagatttt
gaagaagggcaagaatactacgaaagggaagaaggttatgaggaaggtgaggaagagtgg
gaggagacttaccaagaaagagaagtcatccaagttcaaaaggaggcttatgaagaatca
cgtgagaggaaaattccagcaaaagtaccggaaaagaaagaagtaccacctcctaaagtt
gtaaagaagcccgtagttgaaaaaattgaaaagacttctcgaagaatggaagaagttcaa
gtcaccaaagtacccgaagtttcaaagaagattgttccacaaaaaccttctcggactcca
gtgcaggaagaagttattgaagtgaaagtacctgctgtacatacaaagaagatggttatt
tcagaagaaaagatgttctttgcttctcacacagaggaggaggaggtgtcagtcacagtc
cctgaggtacaaaagaaaactgttaccgaagagaaaattcacgtcgctgtttccaaaaag
attgagcctccacctaaagtccctgagccacccaagaaaccagtctcagaagaagtagtc
cctgttccccaccttcctaaaaaggtggagcccctaccagccaaagttcctgaagttccc
aagaaacctgtgccagaggagaaaaagccagttcctgtgcctaagaaggaacctgccgct
cccccaaaagtcccagaggtgcccgggagacctgtccctgaagaaaagattcctgttcct
gttgcaaagaaaaaggaagctccaccagctaaagttcctgaagttcagaagagggttgtc
acagaagaaaaaataaccatcgtcactgaaagggaggaatctccaccaccagcagtgcca
gaaatactaaaggagaaagttcccgaagaaaaaagacctgttcctcggaaagaggaagaa
gttccaccaccaaaagtgccagctctgcctaagaaacctgtccctgaggagaaagttccc
gtgccagttcctgctgctaagaaagcccctcctccccgagctgaagtttctaaggaaact
gtcgtagaagaaaaaagatttgttggtgaagaaaaactatccgttgcagttcctcaaaga
gtggaggtcgtgcagcacgaagtatctgcagaagaggaatggagttattcagaagaagag
gaaagagtatatgtttcagtttatagagaagaggaaagagaggaggaggaggaggaagtg
gagcttacagaatatgaagtgatggaagagcctgaggaatatgttgtagaagaagagctg
cactttatttctgagaaagtggacgttgaaccagccaaagtgcctgagaagaaaattgta
ccaaaaccgaaaactcctgctaaaatagaggagcctccaccagctaaagttcctgaagta
cctaagaaaattgtgccagaaaagaaaattcctgctgcagttcccaaaaaggaaaaggtg
ccaccagccaaagtgccagaagagccaaagaaaccagttcctgaaaaacgggctcctccc
aaagtggctaagatagaagaacctcctcccctcaaagtgactgagaggcacatgcaaatt
gcccaggaagaaaaagttcactttgctgtaactaaaaaagtggagcctccaagaccaaga
gtgcctgaggaacccaagagagctgctccagaagaaaaagttccaaaactcaagcctaga
aaagaggaggagccaccagtaaaagtgactgaactcaggaaaagagctgttcaagaacaa
aaggtatccattgaagttccaaaaagagaacctccagcaggtaaagaagtaactgtaaca
gcagagaaagaatgggcttacacccaggaagaagaaactgtttcagtacaatgggaagag
gaatatgaagaatatgattataaagaatttgaggagtatgaaccaacagaagaatatgat
caatatgaagagtatgaggaacatgaattcgaacattatgaagagtataaagaacatgaa
gaatatgtcacagaacctgagaagcccatcccagtaaagcctgtccaggaagaaccggtt
ctcacaaaaccaaagatcccaccagctaaagtgccgaagaaaatggtccctgaagaaaaa
gtaccagtgcccattcctaagaaactcaaacctccaccgcccaaagtgcctgaagaagca
aagaaagttgttgaggaaaaaatacacatttcaattaccaaacgtgaaaaagagcaggtg
actgaaccagctgataaagtgcccatgaagcccaagagggttgtcacagaagaaaaagta
cctgttcctaaaaaagaagtagcagcacctgttagagtgcctgaagtacctaaaagacaa
ccagaagagattgcctttgaagaggaagctgtaacccaagtagaggaatattttgaagaa
gagtacattcatgaaaaagaagaactcataactgaagaagaagaggaactcaaaactgaa
gaagtggtaccagtggtacccatcaaagtgcctgaggtacccaagaaacctgttccagaa
gagaaacctgttcctgttcccaaaaagaaggaagccccaccagcaaaagtgcctgagatt
cctaagaagccagaggagaaagttcctgtgcccattcctaagaaagagaaggctccacca
gctaaagttcctgaagtacccaagaaacctgtaccagaggagaaagtgccagtaccggtt
cctaaaaaggtggaagctccacctgccaaagtgccagaagtgcccgagaagcctgtgcct
gagaagaaggtgctggttcctgctcctaagaaagtagaggctccatctgcaaaagtgcca
gtggtgcccaagaaggtcatcacagaagaaaaggagccaacacctgttccgaaaaaagtg
gaagctccatcacccaaagtgccaaagaaacgtgagccagttccagttccagttccagtt
cctgtagctctacttcgggaagagaaagttgtatttgaagaagaaattgttcttgaagag
gaagttctacctgaggaagaggaagttccaccagcggaagaggaaattccacccgaggaa
gaggaaattccaccagaggaagaggaagttccaccagaggaagaggaaattctatcagag
gaagaggaagttgctcctgaagaagaggaaattccttttggggaggaagaatttgtacct
gaggaagaagttgtacctgaagaagaagttcttccagaaattaaacctaaggtgccagta
cctgcacgagtgcctgaagtgccaaagaaacctgtaccagagaagaaagtccctgttcca
gctcctaaaaaagtggaacctccaccacccaaagtgcctgaggttaagaagaaagtgcca
gagaagaaagtgatcactcccaagaaagaggaggctcctcctgccacagttcctgaggtg
tctaagaaagcggaagaaagacgaatcattgtccctaaagaagaggaagttccaccagtt
gaagtgtttgaggagcctgaagagcctattccagaagaagagatcccagaggaaccacct
tgcatagaggaggttgaggaggtggcgccacctagagtgcctgaagtggttaagaaagca
gtacctgaagcacctactcctgttcctaagaaagtggaggcaccaccagctaaagtgcca
aagaaggttcctgaagaaaaagtacctgttcctgttcagaaaaaagaggcccctcctgcc
aaagtgcctgaagttcaaaagaaagtcccagaaaagaaagtccctgaaaagaaagtccca
gaaaagaaagtcccagaaaagaaagtccctgtgcctaaaagagaagctgttcccccagct
aaagggagagctgttcttgaagaaaaaatatcagttgctgtccacaaagaggaagtagta
aaagaaagagcagaattagaaatagtggaagcacaagtggaagaagctcatgaagaagag
ttccatgaggttgaagaatactttgaagaagagttccatgaggttgaagaagtcctcaaa
gtagaagagtatagagctgaagaagaagtacacgaagttgaaaaagtccatagagtaata
gaagtcttagaggctgaagaagtagaagtatatgaaaaacccaaagctccacctaaaggg
cctgagatatctgaggaaatcatccctccaaaaaaaccacctactaaagttgttcctcga
aaagagccaccagctaaagtgcctgaagtacccaagaaaattgtggtagaagaaaaagta
catgttcctgaagagcccgaagttccaccagctaaagcacctgaagtacccaagaaaatt
gttccagaagaaaaagttcgtgaagctgttcctaaaaagcctgaagttccaccagctaaa
gtgcctgaagctgctcaagaaggtgttcctgcaaaaagagttccttccaaaaaaagagaa
cctccatcagttaaagtgcctgaagctccccaagaaattttccctgaaaagaaaacatat
gtggttcgtcatgaaaagactgaagcccttcctgatgaagtgcctgaggtgcccgaagaa
gttgtctgggaaaagaaagtgcatcctccccaaaagcctgaagttttatctgtcaaagtg
cctgaggctcccaaagaggttttccctgaaaagaaagtgcctgtggcacctcctaaaaag
cgagaagttccaccagttacagtgcctgaggctcccaaggaatttgcccctgaaaagaaa
gcaccagtggcacctcctaaaaagccagaagtcccacctgttacagtgcccgaggctccc
aaggaagttgtccctgaaaagaaggtgcctgtgatgcctcctaaaaagccagaagtccca
cctgttacagtgcctgaggctcccaaggaagttgtccctgagaagaaagtacctgtgatg
cctcctaaaaagccagaagtcccaccagccaaagtacccgaggtgccaaaggcagctgtc
ccagaaaagaaggtgcctgaagctattcctcccaaaccggaaagtcctcccccagcagtg
cctgaggtgccgccgaaggaagccatccctgaaaagaaagtgcctgtggctcctcctaaa
aagccagaagctctacctgctaaagttccagaagttcctaaagaagttgtacatgaaaag
aaagtggctgtacccaaaaaaccagaagtcccaactgctaaagtacctaaagctgctcaa
gaagttgccccagaaaagaaagttcccaaggcaccacccaaaaaaccggaagccccacct
gtcacagtgcctgaagttcctgaagaagttgtcccagaaaagaaagttcctaaggcaccg
cccaaaaaaccggaagccccacctgtcacagtgcctgaagttcctgaagaagttgtccca
gaaaagaaagttcctaaggcaccgcccaaaacaccggaagccccacctgtcacagtgcct
gaagttcctgaagaagttgtcccagaaaagaaagttcctaaggcaccgcccaaaaaaccg
gaagccccacctgtcacagtgcctgaagttcctgaagaagttgtcccagaaaagaaagtt
cctaaggcaccgcccaaaacaccggaagccccacctgtcacagtgcctgaagttcccaaa
gaagttgtcccagaaaagaaagttcccaagtcaccacccaaaaaaccagaagtcccacca
gtttcagtggctgaagttcctcaagaaattgtccctgacaagaaagcaccagcggcacct
cccaaaaagccggaagccccacctgttacagtacctgaggctccaaaagaagttgtccct
gaaaagaaagtacctgtgatgcctcctgaaaagccaaaagtcccacctgttacagtacct
gaggctcccacggaagttgtcactgaaaagaaggtgcctgtgatgcctcctaaaaagcca
gaagtcccacctgctaaagtacctgaggctcccaaggaagttgtccctgaaaagaaggtg
tctgtgatgcctcctaaaaagtcagaagtcccacctgttacagtacctgaggctcccaag
gacgttgtccccgagaaggaagtacctgtgatgcctcctaaaaagccagaagtcccacct
gctaaagtgcccgaggctcccaaggaagttgtccctgaaaagaaggtgcctgtgatgcct
cctaaaaagccagaagtcccacctgctaaagtacctgaggctcccaaggacgttgtcccc
gagaaggaagtacctgtgatgcctcctaaaaagccagaagtcccacctgttacagtgccc
gaagctcccaaggaagttgtccctgaaaagaaggtgcctgtgatgcctcctaaaaagcca
gaagtcccacctgctaaagtgcctgaggttcccaaagaagttgtccctgaaaagaaagca
ccagtggcacctcctaaaaagccagaagtcccacctgttacagtgcccgtggctcccaag
gaagttgtccctgaaaagaaggtgcctgtgatgcctcctaaaaagccagaagtcccacct
gttacagtgcctgaggctcccaaggaagttgtccctgagaagaaagtacctgtgatgcct
cctaaaaagccagaagtcccaccagctaaagtacctgaggtgccaaaggcagctgtccca
gaaaagaaggtgcctgaagctattcctcccaaaccggaaagtcctccccctgcagtgcat
gaggagcctgaagaaactgccccagaagagcctccagctgaagtcatggaagagccagag
cctgctcctcctccaaaagtgaccgtgccacctaagaaacctgtcccagaaaagaaacca
cctgccgtcattgccaagaaacctgaaccaccaccagtgaaagtgcccgaggtgcccaag
gaagttgttcctgaaaagaaagtgcctccagtggttcccaaaaaaccagaagtcccacct
gctaaagtgcctgaagttccaaaagaagtccttccagaaaagaaagtagatgttcccaaa
aagcccgaagtcccaccagctaaagtgccagaggtaccaaagaaacctgtcttagaagag
aaaccagtcgtccctgttcctgagaaagtcgagtcccctcctccagaagtatatgaagaa
cctgtggaaattgctcctgaagaggaagagccagttcctgttgcagaagaggaggaacca
gaagtcccacctccggcagtgcctgaagagcccaagaagattgttccagagaagaaattt
cctgtcatcaaaaaagcagaacctccaccacctaaagtacctgagatggcaaagaaagtt
gtcccagtgaagaaagtcccaactgttaagaagccagaaacaccagaagttaaagtgtct
gagctgcccaagaaacttgtcccagtaaagaaggaacctgtgcctgttaccaaaaaacca
gaagtccggcgagaaaaagtgcctgaagttcccaaggaagtcatcacagaagagaaagtg
tcagttcctacccctgaagaaccagaatctccacctgtccaagttgaagagtctcctgag
gaaataatatatgaagaaagagcatccataaccattggtagaaaagtgactccccctgtt
gaagaacgtgaaattgaaaagtatgttaagcctgaagaacctgaacctgaaccacagcca
gaagaaataccagtacaagaacctgaacctgaaaagaaggttattgagaaaccaaaactc
aaaccaaggcccccagctcctcctccagctccacctaaggaagacctgaaggagaaaata
ctccagcttaaagctgtttcaaagaagaaagttcctgaaaaacctgaggttctggaaaca
gtggagcttacacctcggaaagtgcttggaggtgaaaagaaagttcgcaaattacttcct
gaacctaaacctcaactaaaggaagaagctgttctcaaaagcgttctaagaaagagacct
gaagaagaaaaacctaaagaagtagaaaaaattaaaaaacctgcagtgccagaaccacct
ccaaaagctgttgaagaggttgaagcacctgcagctcctgttaccaaaagggaaaggaaa
gttcctgaaccagcaaaagtgcctgaaattaagccagcaatacctctccctgcacctgaa
ccaaaaccaaagcctgaaccagaagtgaaaataatcaaaccacctcctttggagcccgca
ccagcccctatcgctgccccagtgacggtgccagtcgttggagagaaagcaggagccaaa
gcaccgaaagaggaggctgccaagccaaaagttcccatcacaggtctagccaaaaagact
ccttcaccaatagaagctgaaaggaaaaagttaagaccaggaagtggtggagagaaaccg
cctgccgaagctccgttcacctaccagctgaaggctgtgccactgaagtttgtgaaagaa
atcaaagacattgtcttgactgaagcagagtcagttggcgcttctgcaatctttgagtgt
ttagtctccccctccactgcagttacaagctggatgaaagatggtagcaatatccgtgag
agcccaaagcacagattcatcgctgatgggaaagacagaaagctgcatatcattgatgtt
catctttctgatgctggcgaatacacctgtgttttacgtctgggaaataaggaaaagacc
tccactgcgaaactgattgtcgaagaacttcctgtgcgttttgtaaaaacgcttgaagag
gaagtcacagtggtcaaaggacagccattgtacttgagctgcgagttaaataaagaacgt
gatgtggtctggaggaaggatggcaagattgtggtggagaaacctggcaaaattgtgccc
ggcatcattggcttgatgcgggccctgaccatcagtgacgcagatgacttcgatgcaggg
acatatacagtgactgtggaaaatgccaacaacctggagtgctcatcctgcgtgaaagta
gtagaagtcattagagactggctggtgaaacccatccgagatcagcatgtgaaacccaag
gggacagctgttttcacctgtgtcatagcaaaggatactccaaacattaagtggttcaaa
ggatatgatgaaatcccctcggaaaaaactgataagactgagatagtaagagatggaaaa
cttatacacctcaaaattaagaatgctatgccagaagatattgatgaatatgcagtggaa
attgaagggaaaagatactctgcaaagctgacacttggagatcgtgaagttgaattgctt
aaaccaatagaggatgttaccatttatgagaaagaaagtgcaagctttgatgcagaaatc
tcagaggcagacattcctggagattggaaactgaagggagaacttctaagaccctcacct
acgtgtgaaatcaaggcagatggtggaaaacgcttcttgactttgtacaaagtcaaactg
gaccaggccggtgaagttctttaccaggcacttaatgcagtcacgactgccattctgaca
gtaaaagaaatcgaacttgactttgccgtgcccctgaaggatgtcacggtcccagaaaag
cgacaggctcgatttgaatgtgtcctcactcgagaggcaaatgttatatggtctaaagga
cctgatataatcaagtcatctgacaagtttgatatcattactgatggaaagaaacacatt
cttgtcatcaataattctcagtttgatgatgaaggggtctttactgctgaagtggagggc
aagaagacctcagcacgattatttgttacaggtataagattgaaattcatatcacctctt
gaagatcaaacagtgaaagaaggtgaaacagcaacttttgtctgtgaactttctcatgaa
aaaatgcacgtagtctggttcaaaaatgatgccaaactccacacaagcagaactgtactc
atctcatcggagggcaagcttcacaagctggaaatgagagaagtgacactggatgatata
tcccagatcaaagctcaggttaaggacctgagctccacagcaaatctgaaggtcttagag
gccgatccctacttcactatgaaattacacgataagactggagtcgagaaggatgagatt
attctgaagtgtgaagtgagcaaagatgtgccagtgaaatggtttaaagacggggaagag
attgtaccttcacccaaatactctatcaaggcagatggcctgcgccgcatcttaaaaatc
aaaaaggcaaaactgaaagacaaaggcgaatacacgtgtgactgtggcacagacaagaca
aaagcaaatgtcactgttgaggcccaactaataaaagtggaaaaacccctgtatggagta
gaagtgtttgtgggtgaaacagctcgctttgaaatcgaactttctgaaccagatgtccat
ggccagtggaaattaaaaggagagcctttaactgcttcccctgactgtgaaatcattgaa
gatgggaagaagcatattctggtcctttataactgccggctggatatgacaggcgaggtc
tccttccaagccgccaatgctaaatctgcagccaatctgaaagtgaaagaattgccactt
atcttcatcacgcctctcagtgatgttaaagtctttgagaaagatgaggctaagtttgag
tgtgaagtatccagggagcccaaaacataccgttggctgaaaggaacccagaaaatcaca
ggcgatgacaaaactgagcttcttaaggatggcactaggcattcactggtgatcagatct
gctgcttttgaagatgaagcaaaatacatatttgaagctgaagataagcacacaagtggc
aaactgatcattgaaggaatccgactcaaattcctcaccccactcaaggatgtaacagcc
aaagagagggaaagtgctgtgtttactgtggagctgtcccatgataacattcgtgttcgc
tggttcaagaacgaccagcgcctgcataccagcaagttggtctcaatgcatgatgaaggg
aaaacccattccatcacattcaaagacctctctattgatgacacctctcaaattaaagta
gaagctatggggttaagttcagaagccaaactcactgtgctagagggagacccatacttc
acaggaaagcttcaagattacactggcacagagaaagatgaagtgattctacagtgtgaa
attagcaaagcagatgcaccggtgaaatggtttaaagatggacaggagataaagccatct
aaaaatgctgttattaaggcagatggcaagaagcgcatgctaatcctaaagaaagccttg
aaatcagatattggacagtacacctgtgactgtgggacagataagacctcaggaaagctt
gagattgaggatcgggaaattaaactggtgcgacccctgtacagcgtggaggtgatggag
actgagacggcccgctttgaaaccgaaatctcggaagatggtatccacgccaactggaaa
ctcaagggagaggcactactccaaacacctgagtgtgagatcaaggaagaaggcaaaatg
cacttccttattttgcacaactgccgcctggaccagaccggtggggtagatttccaagct
gccaatgttaaatctagtgcccacctccgagtaaaaccacgagccattggtcttctgagg
cctctaaaggatgtcacagtgacggcaggagaaacagccaccttccgctgcgagctgtct
tatgaggatatcccagtggaatggtacctcagagggaagaaactagagcccagcgataag
gtggtcacacgttcagaaggaagagttcatgcacttactctgagggatgtaaagttagaa
gatgctggagaagtccaactagtagcaaaagatttcaaaacgcaagccaacctcttcgtg
aaagaacccccagttgaattcactaagcctcttgaggaccagacggtcgaagaggaagcc
actgcggtactggagtgtgaagtatcccgagaaaatgctaaggtgaaatggttcaaaaat
gggacagaaattctcaaaagcaagaagtatgaaattgttgctgatggcagggtcaggaaa
cttattatacacggctgcaccccagaggatattaaaacatacacttgtgatgctaaggat
tttaagacttcctgtaacctgaatgtcgtgcctcctcatgtggacttcttaagaccactc
accgatcttcaagttaaagaaaaagaaatggctcggtttgagtgtgaaatttcccgagaa
aatgccaaggttcagtggtttaaagatggtgctgaaattaaaaagggcaaaaaatatgac
atcatatctaagggagcagtccgcattcttgtcatcaacaaatgtctactggctgatgaa
gcagaatattcctgtgaagtaaggacagcgcgaacttccggcatgctgacagtcctggaa
gaagaagccatctttacaaaaaatcttaccaacattgaagttagtgaaacagacactgta
aaactggtttgtgaggtctctaagcccggagcagaagtaatttggtacaaaggggatgaa
gagatcattgaaacaggaagatatgaaatacttactgttggacgaaagagaaccctgatc
attcagaatgctcacctggaagacactggcaactacaactgccgactcccaagttctcga
actgatggcaaagtcaaagttcatgaacttgctgctgaatttatctcaaagcctcaaaac
gttgaaatacttgaaggagaaaaggctgaatttgtctgctctatatcaaaggaaagcttt
gcagtccagtggaagagagatgataagacacttgaacctggagataaatatgacataatt
gctgatggcaaaaagaggatcctagttgtgaaagatgccacattacaagatatgggcact
tatgtagtcatggttggggctgccagagcagcagctcacttgacagtaattgaaaaactc
aggatcatagttcctctgaagaacacccgtgtgaaggaacaacaagaagctgtctttaac
tgtgaggtcaataccgaaggtgccaaagccaaatggttcagaaatgaagaagccatattt
gatagttcaaaatacattattctccaaaaagacctggtctacaccctcagaattagagat
gcacgattagatgatcaagccaactataatgtgtccctgaccaatcacagaggtgaaaat
gttaagagtgcagccaatctaatcgtagaagaggaagaccttaggatcattgagcctctt
aaagatattgaaacaatggagaagaaatctgtcacattctggtgcaaggtgaaccgtctc
aatgtaagactgaactggaccaaaaatggagaagaggtggcttttgacaaccgtgttttg
tacagaattgataaatataagcactctctaatcattaaagactgtggcttcccagatgaa
ggtgaatacattgtcactgctggacaagataaatctgttgctgaacttctcatcatagaa
gcccctacagaatttgtggaacatttggaagaccagacagtcactgagtttgacgatgct
gtcttctcctgccagctctccagagagaaagcaaatgtaaaatggtacagaaacgggaga
gaaatcaaagaaggcaaaaaatacaaatttgaaaaagatggcagaatacatagactcatt
ataaaagactgcaggctggatgatgaatgtgaatatgcttgtggagtagaagacagaagg
tctcgagctagactctttgtggaagaaatccctgttgagatcatcaggcctccccaagac
atccttgaagcccctggtactgatgttgtctttttagctgagctcaacaaagataaggtg
gaagtccagtggctaaaaaacaacatgattattgtccagggtgacaaacaccagatgatg
agtgaaggaaagatacacaggctacagatttgtgacattaagccccgtgaccagggtgaa
tacagatttattgccaaagacaaagaagccagagctaagcttgaactggcagccgcacct
aaaatcaagacagctgaccaagacctggtggttgatgttggccagcctctgaccatggtg
gtgccctatgatgcctaccccaaagcagaagctgagtggtttaaagaaaatgaacctcta
tcttcaaaaactattgatactacagctgaacagacttctttcagaattttagaagccaag
aaacgagacaaaggaaggtataaaattgtgcttcagaacaaacatggaaaagcagaagca
ttcatcaatttacaagttattgatgttcctgggccagtacgtaacttagaagtgacagaa
acatttgatggtgaagtgagcctcgcttgggaagaaccattaactgatggtggaagcaaa
atcataggttatgttgttgaaagacgtgacattaagagaaagacctgggttctggccact
gaccgtgcagatagttgtgagtttactgtcactagactacaaaaaggaggagttgagtac
ctattccgtgtgagcgcaagaaacagagtcggcactggtgaaccagtagaaactgacagt
cctgtagaagcaaggagtaaatatgatgttccaggccctcctttgaatgtaacgatcact
gatgtggacagatttggtgtctcattgacatgggaaccaccagagtatgatggaggtgcc
gagatcacaaactacatcattgaattaagggacaagacttctatcagatgggaaactgcc
atgacagtaagagctgaagacctgtctgcaactgtcactgatgtggtggaaggacaggag
tacagtttccgggttagggcccaaaaccgaattggagttggaaaaccaagtgcagccaca
ccctttgtcaaagttgctgatccgattgagagaccaagtcctcctgtgaacctaaactcc
tcagatcagactcagtcatcagttcagctcacatgggaacctcctctgaaagatggagga
ggcccaatattgggctatataatagaacgatgtgaagaaggaaaagataattggattcgt
tgcaataagaaacttgtccctgaactgacttacaaggttactggattacaaaaaggaaat
aaatatttatatcgagtatctgcagaaaatgaagctggtgtttcagatccatctgaaatt
cttggtcctctaactgctgatgatgcattcgttgaaccaacaatggatttaagtgcattt
aaagatggcctggaagttattgtgccaaatcctatcaagatcctggttccaagtacaggc
tatccaaggccaactgctacctggtcttttggagataaagtactagaagcaggagaccgt
gtgaaaatgaaaaccctatctgcctatgctgagcttatcatttcaccaagtgaacgtcca
gacaagggcatttacatgctgaagttagaaaatcgtgtgaaaacaatttctggggaggtt
gatgtccgtgtaattgctcgcccaagtgcacccaaagaactgaaattcggtgagataacc
aaggactcagtacatttgacttgggaaccaccagatgatgatggaggaagtccattaacc
ggatatgttgttgaaaagcgagaagtcagccggaaaacatggactaaagttatagactct
gtgaccaacctagaattcacagttactgatcttgttcaaggaaaagaatatttatttaaa
gtctgtgctcataacaagtgtggccctggagaacccgcatatgttgatgaacctgtaaat
atgtcagctcctgcaacggtacctgacccaccagagaatgttaagtggagagatcgaaca
gccaagagcatcttcctaacatgggatccacctaaacatgatggtggttcacgcatcaaa
ggatatatagttgaaaaatgtccacgtggttctgatcgatgggtcgcttgtggagaacca
gttgcagaaacaaaaatggaagtaacaggtcttgaagaaggccagtggtatgcctatcgc
gtgaaagccttgaataggctaggagctagcaagccaagcaaacccacagaagaaatccag
gctgtggacatacaggaggctccagaaattttcctcgacgtgaagctccttgcgggtctc
actgtaaaagcgggaactaagattgagcttcctgccactgtaactggcaaacctgaacct
aaagtaacctggacaaaggctgatacgcttctgaagcaggacaaaagaatcaccattgaa
aacgttcctaaaaaatccacagtgacgatcgtggatagtaagagaagtgacagtggcaca
tacataatcgaggccatgaacgtctgtggtcgggccaccgctgtggtagaagtgaacgtc
ttagataaacctggacccccagctgctttagacatcatggaagtgaccagtgagtcatgt
tttctcacatggaacccaccacgcgatgatggtggatctaaaatcacaaactatgtcgtg
gagagaagagcgaccgacagtgatatgtggcacaagctctcgtcaactgtcaaggataca
aagttcaaggcaaccaaattaacacccaataaagaatatatattcagggttgctgcagaa
aacatgtacggtgttggtgagccagttcagaccactccaataacagccaaatatcagttt
gatccacctggacctccaactcgcctagaaccttctgatatcactaaggatgcagtgacc
ctcacatggtgtgagccagatgatgacggtggcagccccatcacgggttactgggttgaa
agattagatcctgatactgataaatgggttagatgcaataagatgccaataaaggataca
acatacagagtgaaaggtctcaccaataagaaaaaatacagattccgtgtgttggctgaa
aatcttgctggacctggaaaatcaagcagatcaactgagccaatcttaataaaggatccc
atagatcctccatggccccctggaaaaccaaccgtgaaagatgtaggcagaacatcatta
atgttgaattggacaaagccagaacacgatggaggggcaaagatcgagtcttatgtcatt
gaaatgctaaagactggaacagaggactgggtccgagtggccgaaggggttcccaccacc
cagcatttgttcccagggctcatggaagggcaggaatactcattccgagttagagctgtg
aacaaggcgggcgaaagtgaacccagcgaacccagtgactctgtgctttgccgggagaaa
ctttaccccccatcaccacctcgctggcttgaagttatcaatattacaaaaaatacagca
gacctaaagtggacagttcctgagaaagatggagggtcgcccatcaccaactacattgtg
gaaaagagagatgtgaggcggaaaggctggcaaacagtggacacaactgtcaaggacacc
aagtgcacagtgaccccactgaccgagggttctttatacgtgttccgagttgctgcagaa
aatgccataggacagagtgactattgtgaagtcgaggactctgtcctggccaaagacacc
tttaccacccctggaccaccctacgctctgacagtggttgatgtgacgaaaggacatgtt
gacctgaagtgggaaccacctaaaaatgatggtggaagaccaatacagagatacgtcatt
gagaagaaagaaaagttaggtacccgttgggtgaaagctgcaaagacctcaggacctgac
tgtaactttaaagtaactgatgtcattgaaggaacagaggtccagtttcaggttcgggca
gagaatgaagctggaattggacacccaagcgaacccacagaaatcctgaaaattgaagat
ccaacaagtcctccttcatctccccttgacctgcatgtgaccgatgctgggagaaagcac
attaccattgcttggaagcctccagagaaaaatggtggaagtcctattataggataccat
gttgaaatgtgtccagtaggcactgagaaatggatgcgagttaattctcgcccaataaaa
gacttgaaattcaaggttgaagaaggtgttgtgcccgacaaggagtatgttctgagagtg
agagccgtcaatgctgttggtgtcagtgagccatctgaaatctccgaaaacgtggttgcc
aaagacccagactgcaagccaacaattgatctggagactcacgacattgtcgtcattgaa
ggtgaaaaattaagcattcctgttcccttcagagctgtcccagttccaaccgttagctgg
cataaagatggcaaagaagttaaagcaagtgatagattaacaatgaagaaggatcacatc
tctgcacaccttgaagttcccaagagtgtccatgcagatgctggagtttacaccattacc
ctggagaatacgcttggctcagcaactgcctcaatcaatgtcaaagtcataggcctacct
ggaccatgcaaagatcttaaagcaagtgacgtgaccaagagttcttgtaaattaacctgg
gaacctccagaatatgacggtggaagcccaattcttcattacgtcctagaacgcagagaa
gctgggaggaggacgtatataccagtcatgtctggtgagaacaaactgtcttggacagtc
aaagatctcataccaaatggtgaatacttcttccgtgttaaagctgtcaacaagattggt
ggaggcgaatatattgaactgaaaaatccagtcattgctcaagatccgaagcagccccct
gatccacctgtagacgttgaggtacataatcctacagctgaggcaatgactatcacatgg
aagccacctttgtacgacggagggagcaagataatgggttacatcatagagaagattgct
aagggtgaagagagatggaagagatgcaacgaacacctggtaccagtcctgacctataca
gcaaaaggccttgaagagggaaaggaataccaattccgtgtgcgagcagaaaatgctgct
ggtattggcgaaccttctcgggccactcctccaaccaaagccttagatcctattgatgcc
ccgaaagtcattatgagaacaagcctagaagtgagacgaggtgatgaaatagcactcgat
gcaactatctctgggtcaccttatccaactattacgtggttaaaggatgaaaatgttatc
acaccagaggaaattaggaagcgggtagcacccttggttaggaggaagaagggtgaagtt
caagaagaagaacgatttgtcctgcctctgacacagcgtttgagtatcgacaacagtaaa
aaaggagaatctcagctacgtgtccgagattctctccgacctgatcatggcctgtttatg
atcaaagttgaaaatgaccatggtattgcaaaagctccttgtaccgtcagtgtgctagat
acaccaggaccaccaatcaactttgtatttgaagatattagaaagacctcagtcgtctgt
aaatgggaaccaccccttgatgatggtggcagtgaaattttaaactacactttggaaaag
aaagacaagacaaaacctgactcagaatggattgccgtcacttcaacacttagacattgc
aaatattcagtgacaaagttgattgaaggaaaagagtacctcttccgtgtaagagctgaa
aataggtttgggcctggaccaccatgtgtttcaaagccacttacagctaaagatccattt
gaaccacctgatgcacctgataagcccattgtggaagatgtcaccagtaacagtatgcta
gtgaaatggaatgaaccaaaagataatggaagccccatcttgggttactggcttgaaaaa
cgtgaggtgaatagcacacactggtctcgtgtcaaccgaaaccttctgaattctttgaag
accaatgcagaaggcctgttagagggactcacctatgtcttcagagtacgtgccgaaaat
gcagctggacctggaaagttcagtcccccctcagatcccaaaacagcacatgatccaatc
tctccacctgggccacctgtcccaagagtcactgacacaagttccacaactattgaactg
gcatgggaacccccagctttcaatggtggtggggaaattgttggctactttgttgataag
cagctcgttggcacaaatgaatggtcccgctgcacagagaagatgatcaaggcccgtgag
tacactgtcaaagaaatccgagagggtgccgattacaaacttcgagtgagcgctgtcaac
gctgcaggtgaaggaccgcctggagaaacagaacccgttactgtggctgaaccacaagag
cctccaaatgtggaactagatgtttctgtcaaggctggaatacagatcatggctgggaag
actctcagaattccagctgtggtcactggtcgtccagtgccaacaaaagtgtggaccata
gaagaaggagagctggataaagaccgtgttgaaatagagaacgttggaaccaaatctgaa
ctaattatcaagaatgcattaagaaaagatcatggcagatatgtgattacagctaccaat
agctgtggttctaaatttgcagcagcccgggtagaagtttttgatgtccctggtccagtt
cttgatttgaaacctgttgtaacaaacagaaaaatgtgtctgcttaactggtctgatcca
gcagatgatggaggaagtgacatcacgggctttattattgaaagaaaggatgctaagatg
catacttggagacaaccaatagagactgagagatctaaatgtgacatcacaggtctcctt
gagggacaagaatatatgtaccgtgtgattgccaagaacaagtttggctgtggccctcct
gttgaagtaggaccaattcttgcagttgacccactaggtcctccaacgtctcccgagagg
cttacatatacggaaaggaccaagtccactatcaaccttgactggaaagagccccgcaat
aatggtggctgccccatccaaggctatatcattgaaaaacggcgtcaggacaaacctgac
tttgaaagagttaacaagcgactctgcccaaccacatctcttctggttgaagatcttgat
gaacaccaaatgtatgagttccgtgtcaaggccgtcaacgaaattggtgaaagcgaacca
tccctgcctcttaatgtggtcatacaagatgatgaagtgcctccaactattaagttgcgc
ctgtctgttcgaggagacaccatcaaagttaaggcgggagagcctgttaacatccctgca
gatgtgacaggccttccaatgcctaaaattgagtggtccaagaatgaaactatgattgaa
aaacccaccgatgcacttaagataaccaaggaagaagtatcccgaagtgaggcaaagact
gagcttagcattcccaaagcaacccgggaggacaaaggcacttacacggtgactgcttct
aatcgccttggctcagtgttccgaaatgtccatgttgaagtatacgatcgtccatcccca
ccaagaaatcttgctgttattgacattaaagctgaatcttgctacttaacgtgggatgcc
cctctagacaatggtgggggtgaaatcacccattatgtcattgacaaacgcgatgcaagc
aggaagaaagctgaatgggaagaagtcaccaacactgctgtagagaggagatatgggatc
tggaaacttatccccaatggtcagtatgagttccgagttagggcagtgaataaatatgga
accagcgatgaatgcaaatcagataaagtggtcattcaagatccttatcgcactcctgga
cctccgggaaagccaaaagttttggagcgcaccaaagggtcgatgctagtgagctggact
cctcctctggacaacggcggctctccaattactggctactggctggagaagagagaagag
ggaggtgcctactggtcacgtgttagccgagcaccgataaccaaagtgggattgaaaggc
gtggaatttaatgttccccatttgattgaagatgttaaataccagttcagagcgatggca
ataaacgctgcaggagttggctctcccagtgaaccatcagacctagctgttgcaggagat
cccatatatccacctgggccaccttctcacccagaggtcaaagataaaacaaagtcaagc
atctcactagcatggaaacctccagccaaagatggtggcagtccaatcaaaggatacatt
gtagaaatgcaagaagaaggtactactgactggaaaagcgtaaacgaaccagacaaactt
ctaactacctgtgaatgtgtggtgccgaatttgaaagagctcaggaagtacagattccga
gtgaaagctgtcaatgaagctggtgaatctgaaccaagtgatacaactggagagatccct
gccactgatattcaagaggtaccagaaattttcattgacattggagcacaagactgtctg
atttgtcaagctggcacacacattaggattcctgctgtcatcaagggacgcccaacacca
aaatcatcttgggaatttgatggaaaggcaaagaaggcaatgaaggatggggttcatgac
atacctgaagatgcacagctggagactgctgaaaactcatccgtaattattattccggaa
tgtaaacgatctcattcaggcaaatacagcatcacagccaagaataaagcaggacaaaag
actgcaaattgcagagttaaagtcatggatgtaccagggccacccaaagatctgaaagtc
agtgacatcacaaggggtagttgcaggcttacatggaagatgccagatgatgatggagga
gacaggatcaaaggctatgttatcgagaagaggactattgatggaaaagcttggactaaa
gtcaatccaaactgtggaagcacttcatttgtagttcctgacctcatctctgaacaggaa
tacttcttccgcgtgcgggcacaaaaccgttttggtattggtgctcccgtggaaaccatt
cagaggaccactgccagagatccaatatatcctcctgatccccctattaaactcaagatt
ggcctcataacaaagaacacagtacacctgtcatggaaacccccaaagaatgatgggggc
tcccctgtcacccactatattgttgagtgccttgcgtgggatcctactgggacaaagaaa
gaagcatggaaacagtgcaataagcgcgacgtggaagaactggagtttacggtggaagac
ctggtagagggtggggaatatgaattcagagtcaaagctgtcaatgctgcaggagtcagc
aaaccttcagccattgttggccccgtgactgtcaaagaccagacatgcccaccttcaatt
gagctaaaagaattcatggaggttgaagaaggaactgatgttagcatcgtggccaaaatt
aaaggtgtgccattcccgacactaacctggtttaaagctcctccaaagaagcctgataac
aaagaacctgttgtctacgacacccatgtcaacaaactggtggtggatgatacctgcact
ctagttattccacagtctcgcaggagtgacactggcttatataccatcacagctgtgaat
aatctgggaacagcatcaaaggaaatgaggctgaatgtccttggtcgccctggccctcca
gtgggaccaataaagttcgaatctatttcagcagatcaaatgacattatcttggcttcca
cctaaagatgatggtgggtctaagattacaaactacgtaattgagaaaagagaagctaac
aggaagacatgggtgcgtgtctccagcgaacctaaagagtgcacgtacacaattccaaaa
ctgctagaagaccatgaatatgtattccgaatcatggcccagaataaatatggcattggg
gaacctcttgacagtgaaccagaaacagcaagaaacctcttctctgtccctggagcacca
gataaaccaacagttagcagtgtgactcgaagctccatgactgtcaactgggaagagcca
gaatacgatggaggctctcctgtgacaggatactggctagaaatgaaagacaccacttca
aagagatggaagagagttaaccgagatcctatcaaagccatgactttgggtgtttctcat
aaagtgactggtcttattgaaggttctgattatcaattccgggtgtacgcaatcaatgct
gctggtgtgggtccagcaagtctgccatcagacccagtgactgctagagatcccattgcc
cctcctggacctccatttcccaaagtcacagactggactaaatcatctgcggatttggag
tggtctcccccactaaaagatggtggatccaaaataacgggatacattgttgaatataaa
gaagaaggaaaagaagaatgggaaaaggctaaagaaaaagaagtgagaggaacgaaactt
gttgtgacaggattaaaagagggagcattctacaaatttagagttagagcagtcaacatt
gccggcatcggagaacctggagaagtcacagatgccattgaaatgaaggacagaattgta
ttacctgaccttcagttagatgccagcgtcagagacagaattgtggtccatgctggaggg
gtgattcggatcatcgcctatgtatctggcaagcctcctccaaccgttacctggagtatg
aatgaaagagctttacctcaagaggccaccattgagaccacagccattagctcatccatg
gtcatcaagaattgccagaggagccaccaaggcgtctatgctcttcttgctaaaaatgca
gggggggaaagaaagaagacaattatcgttgatgtattagatgtgccaggtcctgttgga
ataccattcctgtctcacaacctaaccaacgactcctgcaaactgacatggttttctcca
gaagatgatggaggctctccagtcaccaattatgtcattgaaaagcgggaagatgaccgc
agagcatggaccccagtgacatacacagttacccgacaaaatgccaccgtccagggtctc
attcaaggaaaagcctactttttccgaattgcagctgaaaatagtattggtatgggcccg
tttgttgagacaacagatgcgcttgtcataagagatccaataactgtaccagagcgtcct
gaagacctagaagtcaaagaagttgctaaagattctgttactttgacttggaatccccct
aagtatgatggcggatccgaaattatcaactatgtcctagaaagccgtctcattggaact
gagaagttccacaaagttacaaatgacaacttgcttagcaggaagtacactgtgaaaggc
ttaaaagaaggcgatacctatgagtaccgtgtcagtgccatcaatattgttggacaaggc
aaaccatcattttgtaccaagccaatcacttgcaaggatgagctagctcctccaacgctt
gacctcgacttcagagataaactcacgattcgagttggtgaagcttttgccctcactggc
cgttactcaggcaaaccaaagcctaaggttacttggttcaaagatgaagttgatgtgctg
gaagatgatcgcactcatataaagacctcgccaacaacacttgctctagagaagctcaag
gccaagcgttcagattctggcaaatactgtgtggttgtggagaacagtacaggctccagg
aaaggtttctgtaaagttaatgtcgttgaccgtcctggaccaccggtaggaccagttgtt
tttgatgaggtgaccaaagattacatggttatctcttggaagccacctttagatgatgga
ggcagtgaaattactaattatattattgagaagaaggaagtgggcaaagatgtttggatg
cctgtgacatctgcaagtgctaaaacaacatacaaagtttctaaactgcttgaaggaaaa
gattatattttccggatacatgctgaaaatctgtatggaataagtgatcctctggtgtct
gattcaatgaaagccaaagaacgtttcagggttcctgatgcacctgaccagccaattgtt
acagaagttaccaaagactctgcattagtcacctggaacaagccaagtgatggaggaaag
cccatcacaaactacatcctggaaaagagggaaactatgtctaaacgatgggctagagtt
accaaagagcctatccatccatacactaaatttacagttcctgatcttctagaagggtgt
cagtatgaattccgggtttctgcagaaaaccaaattggtattggagacccaagcccacca
tccaaaccagtctttgctaaagatccaattgtgaaaccaagtccacctattaatcctgaa
gcaatagatacgacacataattcagttgatctaacctggcagccaccacgtcatgatgga
gggagcaagattctgggttatattgttgaataccagaaagttggagatgaagaatggaaa
agagccaatcacactcctgagtcatgtcctgaaactaactataaagtcactggtcttcgg
gatggtcaatcctataagttcagagtactagcagtcaatgtagccagtgagtcagatcca
gctcatgttcctgagccagtgctagtaaaagacagacttgaaccccctgagttgattctt
gatgccaacatggctagagagcaacacataagggttggtgatactctaagacttagtgct
gtcatcaaaggagtgccattcccaaaagtaacttggaaaaaagaagacagagaggctcca
actaaagcaagaattgatgttactccagttggtagcaagcttgaaatttgtaatgctgcc
catgaagatggtggaatttattccttaacagtggagaatccagctggttcaaaaactgtc
tcagtaaaagtacttgtattagataagcctgggccacctagagatctggaagtcagtgaa
attaggaaagattcttgttaccttacttggaaggaaccactggatgatggtggttctgtt
attacaaattatgtggttgagaggagagatgttgccagtgcccagtggtcacctctttca
actacatcaaagaaaaagagccactttgctaaacatcttactgaaggcagtcagtatctc
ttccgagtagctgctgagaaccagtatggacgtggtcctttcgtagaaacatctaaaccc
atcaaggctctggatcccctacatcctccagggccacccaagaacctacaccatgtagat
gttgacaagactgaagtctcccttgtttggaataagccagatcgtgatggtggctctcca
atcactggatatttggtggaatatcaagaagagggcacccaagactggattaagttcaag
actgtgacaaactcagagtgtgttgttaacggactacaacaaggaaagacctatagattc
cgtgtaaaagctgaaaacattgtgggtcttggtcttcctgacacaactatcccaatagaa
tgtcaagaaaaactagtgcctccctctgtggagctggatgtgaaattaattgaaggcctt
gtggtaaaagctggaactacagtcagattccctgccattataagaggtgtacctgttcct
accgcaaagtggacaaccgatgggaatgagattaaaacagatgaacaccatacagttgaa
actgacaacttctcatcagtactcaccattaagaactgcttaaggagagacactggggaa
tatcagatcacagtttccaatgcagctggcaccaaaacagtggctgtacatcttactgtt
cttgatgttcctggtccaccaacaggccctattaatattctggaaattacccctgaacat
atgactatctcatggcagccacctaaggatgatggaggaagccctgtgataaattatatt
gttgagaaaaaagacacaaagaaagacacatggggtgttgtctcttcaggaagcagtaag
acaaagctgaaagtcccacatctgcagaagggctgtgaatatgtcttccgagtgaaagca
gagaataagattggtgttggccctccccttgactccatacctactgttgctaaacataag
tttagtcctccatctcctcctggtaaaccagtagttactgacattactgaaaatgctgca
acagtgtcttggactctgccaaaatctgatggtggcagtccaataactggttactatgtg
gaacgtcgagaagtaacaggcaaatggatgagggtcaacaaaacacctctagcggacctg
aagtttagagtgactggactctatgagggaaatacgtatgagtttagagtttttgctgag
aatcttgcaggactaagcaacccgtccccaagttctgatccaataaaagcttgccggccc
atcaaaccacctggaccacctattaatcctaagctgaaagacaagaccagagaaacagct
gacctggtgtggacaaagcctctcagtgatggtggtagccccattctgggctatgtagtg
gaatgtcagaaagctggagcaacacagtggagcaggattaataaagatgaactcattagg
caatgtgcctttagagtacctggactaattgaaggaaatgagtacagattccgtataaag
gcagctaatattgtgggagagggagagccaagagaactagcagaatctgtaattgcaaag
gacatccttcatcctccagaagtagaacttgatgttacctgtcgtgatgttattaccgtt
agagtgggccaaactatccgcattcttgctcgggtcaaaggcagacctcaaccagacata
acttggtccaaggaaggcaaagtattggcccgagaaaagcgggttgacctaattcacgat
ctacctcgtgctgagctgcaaattaaagaagctgttagagctgatcatggaaagtatatc
atctcagctaagaacagcagtggacatgcccaaggttctgctattgttaatgtccttgac
agacctgggccttgccagaatttaaagatcagcaacgtaaccaaagagaactgtacaatt
tcttgggaaaaccctctagataacggtggctcagaaataacaaacttcatagtggaatat
cgcaaaccgaaccagaaaggctggtcaattgttgcttcagatgtcactaagcgattaatc
aaggccaaccttttagccaacaatgaatactatttccgagtttgtgcagagaataaagta
ggtgttgggccaaccactgaaacgaaaactccaattctggctattaaccctattgataga
ccaggtgagcctgaaaaccttcatattgcagataaaggaaagacatttgtctacctaaaa
tggaggcggcctgattatgatggtggtagcccaaacctatcatatcatgttgaaaggaag
ctgaagggctctgatgactgggaaagggtgcataaaggaggcattaaagaaacccactac
atggttgacaaatgtgttgaaaaccagatttatgagttcagagtgcaaacgaagaatgaa
ggtggggaaagtgactgggtgaagacagaggaagttgttgtaaaggaagacctgcagaaa
ccagtacttgatctgaaattaagtggtgtgctaactgtcaaagcaggggacgccattcga
cttgaggcaggtgttagaggcaaaccatttccagaagtttcatggaccaaggacaaagac
gcgacagacttaacaagatcaccaagagccaagattgttaccagtggtgattcatctaaa
tttactcttactaaagcagagcgaagtgatggtggtaaatatgtaattacagcaactaac
acagctggcagttttgtggcctttgccactgtcaatgttttagataagcctgggcctgta
agaaatctgaaaattgttgatgtgtgtagtgataggtgttctcttcgctgggatccacca
gaggatgatggtggctgtgaaatccaaaattatattttagaaaaatgtgagagcaagaga
atggtttggtctaccttttctgctactatcttaatacctggtactacagtaacacgtctc
atagaagggaatgaatatattttcagagtccgtgcagaaaataaaataggcacagggcct
ccaacagaaagtaaaccagtcattgcaaaaaccaaatatgatagacctggtcgccctgac
accccagaagtcactaaagtaagcaacgaagagatgactgtggtttggacgccacctgaa
tatgacggtggaaagtccatcacaggatactatttggagaaaaaggaaaaacattcaaca
cgatgggtccctgtcaacaagagtgcgatccctgagagacgtttgaaagtacagaatctc
ctcccaggacatgaatatcagttccgtgtcaaggcagaaaatgaagttggaattggagaa
ccaagcttgccatcaaggccagtggtggcaaaagaccccatagaaccacctggtccaccg
accaatctcaaagtggttgatacaaccaaaagtaccataactcttgggtggggaaaaccg
gtgtatgatggtggcgcaccaatcattggatatgttgtggaaatgagaccaaagagacca
gatacatcacctgatgaaggctggaaaaggtgtagtgctgcagtgcaactcgttcgcatg
gaattcaccgtgacaagcttggatgaaaaccaggaatatgagttcagggtttgtgcccaa
aaccaagttggcattgggcgccctgcagaactaaaggacgctattaaacccaaagaaatc
ctagaacctccggagattgatttggacgccagcatgagaaaactggtcacagtgagagca
ggatgccctattcgactatttgccatagtgagagggcgaccagcccctaaggtcacttgg
cgaaaagtgggtattgataacgtggtcagaaagggacaagttgatctggttgatactatg
gccttcctcgtcatccccaattctacccgtgatgactcaggaaaatattccttgacgctt
gtgaacttggcaggagaaaaggccgtgttcgtgaatgtcagagtattagatactcctgga
cctgtgtctgatttaaaagtttcggatgtcactaaaacatcatgccacatttcctgggcc
cctcccgagaacgatggtgggagccaagtgacacattacattgtgcagaaacgtgaggca
gatagaaagacgtggtcaacagtcaccccagaagtcaagaaaacgagcttccaagtcacc
aatcttgtccctgggactgagtatttcttcagagtaactgctgtcaatgagtatggcccc
ggtgtcccaacagacatccccaaaccagtgcttgcaacagatcctctaagtgagccggat
ccccccaggaaactagaagttactgaaatgacaaagaacagtgctgcattagcctggtta
cctcccctgcgcgacggaggcgctaaggtcgacggctacatcgttagttacagagaagaa
gagcagcctgcaggtcgctggacacagtactcggtggtgaaagacctcagccttgtcatc
actggccttatggaaggaaagaaatacaaatttagggtagcagccagaaatgccgttgga
gtcagtttgccaagagaagctgagggagtgtatgaagccaaagcacagctgttgccaccc
aagatccttatgccagagcaagttattatcaaagctgggaagaaactccgaattgaagcc
catgtgtatggaaagcctcatcctatctgtaaatggaaaaaaggagaagatgaagttgtc
acatccagccacttggcagtacataaagcagacaattcttcagttctgatcgtaaaagat
gttactaggaaagacagcggttactatagcctcactgcagagaacagttctgggacagac
actcagaaaatcagagttatcgtcatggatgttcctggaccccctcagcctccgtttgac
atttctgacatagatgccgatgcttgctccctgtcatggcacatccccctggaggacgga
ggcagtaacgtcaccaattacatagtggagaagtgtgacgtgagcaggggtgactgggtg
atagcgctagcttcagtgacaaaaacttcctgcagggttggaaaactgatcccaggccaa
gagtatatcttccgggtccgtgctgagaatcgatttggcatttcagagcctctcacgtct
ccaaagatgctggctgagttcccatttgatgttcccagtgaacccaagaatgcacgagtc
actaaagtcaacaaagactgcatatttgtggcgtgggatagaccagacagtgatggaggg
agccccattaccggctacctgattgaacgcaaagaaagaaacagtttgctctgggtgaaa
gctaacgatacccctgtccggtcaactgaatatccctgtgctggcctggtagaaggcctt
gagtattcattcagaatctatgccctaaataaagctggatccagcccccccagcaaacca
actgaatatgtaactgcgagaacgccagttgatcctcctggaaagcctgaagttattgat
gtttccaagagtactgtgtccctcatctgggcccgtccaaagcatgatggaggaagcaaa
attactggctatttcgtagaagcttgcaaacttcctggtgataagtgggtacggtgtaat
acttcacctcaccagattccccaggaagagtacacagctactggcttagaagagaatgct
cagtatcaatttagagcaattgccaagactgcggtaaacattagccagccttctgaacct
tctgatccagtgactattgtggcagaaaatgttcctcccaggatagacctgagtgtggct
atgaaatctttgctcactgtgaaagctggaactaacgtttgcctggatgctactgttttt
ggtaaaccaatgcccacagtctcttggaagaaggatgggacgccgctgaaagcatcggaa
ggcatcaagatggccatgcagcggaacctgtgtaccctagagctgttcagcgtgaatcgg
aaagactcaggggactataccatcactgccgaaaacgcaagtggctccaaatcagccacc
atcaagctcaaagtgttagataaaccaggtcctccagcatctgttaaaatcaacaaaatg
tattcagatcgtgcaatgctttcttgggaacctcctcttgaagatggaggctcagaaatc
accaactatgttgttgacaaacgtgaaacgagcagacccaactgggcacaagtctctgcc
actgtgcccatcaccagctgcagcgtggagaaactgatagagggccatgagtatcagttc
cgaatttgtgctgaaaataaatacggagtgggcgagccgatcttaactgaaccagcaatt
gctaaaaacccatatgacccacccggacgctgtgatcctcctgttattagcaacataacc
aaagatcacatgacagtaagctggaaaccaccagcagatgatggcggctcccccatcact
ggctatttggttgaaaagcgggaaacccaggcaattaactggactaaggtcaacagaaaa
cccgttatagaaagaacgataaaagcaacaggtctccaagaaggcacggaatatgagttc
cgagttacagctataaataaggctggaccaggcaaacccagtgatgcatccaaagctgct
tatgcccaagatcctctgtatcctcctggtccaccagcttttcccaaagtatatgataca
acccgtagctccgtgagtctatcttggggcaagccagcctatgacggtggtagccctatc
attggttaccttgttgaagtaaaacgagctgattctgataactgggtgaggtgcaattta
ccacagaagctacagaaaacccgctttgaggttaccggcctaatggaaaacacagaatat
cagttccgcgtgtatgccgttaataagataggctatagtgaccccagcgatgtgccagat
aaacactgtcccaaggacattttaattccacctgagggagaacttgatgctgatttgagg
aaaacactcatattacgtgctggagttacaatgagactgtatgtaccagtaaaaggacgt
ccacctcccaagataacttggtctaaaccaaatgtcaatctaagagaaaggattggactg
gacataaagtcaactgactttgacactttcttgcgctgtgaaaatgtgaacaaatatgat
gcaggaaaatatatcttgactctgaagaacagctgtggtcaaaaagaatataccattgta
gtgaaagtgcttgacactcctgggccacccatcaatgtgactgtcaaagaaatatccaaa
gattctgcttatgttacctgggatcctcccatcattgatggcggaagccccatcataaac
tatgtggtagaaaagcgtgacgcagagagaaagtcctggtccaccgtgacaacggagtgc
tccaaaacaagcttcagagtttctaacttggaggaaggaaaatcctacttcttcagggtg
tttgcggaaaacgagtacggcattggtgatcccagtgaaacacgtgatgccgtgaaagct
tctgaaacccctggaccagttgtggaccttaaagtgacgtctgtgaccaagtcatcttgt
agcataggctggaaaaagcctcgcagcgatggtgggagtcgaattatcggatatgtcgtt
gatatcctgactgaagaaaataagtggcaacgagtcacgaaatcactaaacttacagtat
tccatgaaagatttgactgaaggggaggaatacaccttcagagtgagtgctgagaatgaa
aacggagaagggaccccaagtgaaatcactgttgtggcaaaggatgatgtcgtggctcct
gaccttgacttaaaggaccttcctgatttgtgctacttggctaaagaaaacagcaacttc
cgtcttaagatccccataaaaggcaagccagctccatccgtgtcctggaagaaaggagaa
gatcctctagcaacagacacaagggtcagtgtcgagtcatcggcagttaacacaactctt
gtagtgaatgactgccaaaaatctgatgctggaaaatacacaatcacactgaagaatgtt
gccggcaccaaggaaggaactctctccataaaagttgtcggtaagcctggcatccccacc
ggaccgatcaagtttgacgaagtcacagcagaagccatgaccttaaagtggggccctcca
aaggacgacggaggttctgagatcaccaactatatcctagagaagagagattctgtaaac
aacaagtgggtgacatgtgcctcagctgtccagaaaaccacctttagagtcatgagactt
catgagggtatggaatacaccttcagggtcagtgccgaaaataaatacggtgtaggagag
ggcctgaaatcggagccaattgttgctagacatccatttgatgtgcccgatgctccccca
cctcccaatattgtggatgtcagacatgattccgtatctctaacttggactgaccccagg
agaaatggaggctctccaattacagggtatcatatcgagttcaaggaaagaaatagcctt
ttgtggaagagggctaacaagactcctgttaggatgaaagacttcaaagtgacaggacta
actgaaggtctggaatatgaattccgagttatggcaatcaatttagcaggagtaggcaag
ccaagcctgccatcagagccagttgtggcacttgatccaattgatcctcctggcaaacct
gaagttattaatgtaacaaggaattcagtgactctcatttggactgaacccaaatatgat
ggtggtcataagttgactggatacatagtggagaagcgagatcttccctctaaatcttgg
atgaaagccaaccatgttaatgtcccagattgtgcctttactgttactgaccttgttgag
ggtggaaaatatgaattcagaattagagcaaagaatacagcaggtgctatcagtgctcca
tcagaaagtacaggaaccattatttgcaaggatgaatatgaggcaccaaccattgtcctt
gatcccacaataaaggatgggctaacagttaaagcaggtgacaccattgttttgaatgcc
attagcatcctcggcaagcctcttccaaagtcaagttggtccagggcaggaaaagacatc
agaccatcagacatcattcagataacttcaaccccaacatcttccatgcttgctatcaag
tatgccactagaaaagatgctggtgaatacaccatcactgctaccaatgcttttggcaca
aaggaggagcatgtgaaggtgatagtcctcgatgtacctggtcccccaggtccgatcgaa
gtcagtaatgtttctgctgaaaaagcaacgcttacatggacacctcccttagaagatggc
ggctcaccaattaagtcttatgttcttgaaaagagagaaaccagccgacttttgtggaca
gtggttgccgaagatattcagtcttgcaggcatgtggcaaccaaacttatccagggaaat
gagtacctcttccgggtctcagccgtaaaccagtatggcaaaggggaacccgtacagtcc
gaacctgtcaagatggtagacagatttggtccacctggcccccctggaaaaccagaggtg
tccaatgtcactaaaaacactgccactgtcagttggaaaagaccagttgatgatggtggc
agtgagatcacagggtatcatgtagaaaggagagagaagaaaggcttgcgatgggtgaga
gcaacagggactccagtttccgatctcagatgcaaagtaacaggactgcaagaaggaaac
acctacgaattccgtgtcagtgcagagaacaaagcaggaattggtccacctagtgatact
tcaaatcctgttctaatgaaagatgtagcatatcctccaggaccaccctcaaatgcacgt
gtcactgataccaccaagaaatctgcttctttggcatggggcaagcctcattatgatggt
gggcttgaaatcactggctatgtcgtagagcatcaaaaagtaggagatgatgcctggata
aaggatacgacaggaaccaccctcagaatcaccgagtttgtcgtccctgatcttcagact
aaagaaaaatacaattttagaatcagtgccatcaacgatgcaggtgttggggagccagca
gtgatttcaaatgttgaaattgtagaacgggagatggctcctgatttcgaactagatgct
gagcttcgaagaacccttgttgtgagagcaggactcagtattagaatatttgtgcccatt
aaaggtcgtcctgctcctgaagtgacatggaccaaagatgatatcaaccttaaaaaacga
gctaacattgaaagtacagagtcgttcacgctcctgatcatcccagaatgtaacagatat
gacaccggtaaatttgtgatgaccattgaaaaccccgctgggaagaaaagtggtttcgtt
aacgtcagagtcttggatacaccaggacctgtccttaacctgaggcctactgacatcaca
aaggagagtgtcaccctgaactgggacctcccactgatagatgggggctcacatataaca
aactacattgtggagaaacgagaagcaacacggaaatcttactccacggtcaccactaag
tgccctaaatgcacatacaaagttactggcttgtctgaaggatgtgaatacttcttcaga
gtgatggcagaaaatgagtatggaattggtgagccgacagaaacaacagagcctgtaaga
gcctccgaagcaccatcaccaccagacagtcttaacattatggacataactaagagcaca
gtcagcctggcgtggcctaaacccaagcacgatggtggcagtaagatcactggctatgtg
attgaagcccagagaaaaggctctgaccagtggacccacatcacaaccgtgaaggggtta
gaatgtgttgtgaaaaatctaactgaaggggaagaatataccttccaagtgatggcagtg
aacagtgcagggagaagtgcccctagagaaagccgacccgtcattgtcaaggagcagaca
atgcttccaggattggatctccatggcatttatcaaaaattagtcattgctaaagctggt
gacaacatcaaagttgaaattccagtgctaggtcgaccaaagcccacggttacatggaag
aaaggagaacaggttcttaaacagacacagagagttaattttgaaaacacagcaacttca
accatcttaaatatcaacgagtgtttaagaagcgatagtgggctctacccattaacagca
aagaacattgtgggagaggttggtgatgtcatcaccattcaagtccatgatatcccaggg
ccacctactggaccaatcaaatttgatgaagtttcatctgattttgtcaccttctcttgg
gacccacctgagaatgatggaggtgtacccataagcaactatgtagtagaaatgcgacag
actgacagtaccacatgggttgagttagcagccaccgttatacgcactacctacaaagcc
actcaccttactaccggagtggagtatcaattccgggtaaaagctcaaaacagatacgga
gttggaccaggcatcacatcagcatctgtagctgccaactatccatttaaggttcctggg
cctcctggtacccctcaggtaactgcagttaccaaggattcaataacaatcagctggcat
gagcctctttctgacggtggaagccccattttaggataccacattgaaagaaaagaacga
aatagtattctctggcagacagtgagcaaagcattagtaccaggcaacattttcaaatca
agtggacttacagatggtattgcttatgaattccgcgtgatcgcagaaaacatggctggc
aaaagcaagccaagcaagccatctgaacctatgttagctttggatcccattgaccaacct
gggaaaccggttcctctaaatattactagacacacagtgacccttcaatgggctaagcct
gaatatactggaggctttaaaattaccagttatatagttgaaaagagagattttcctaat
ggacggtggctgaaagccaacttcagcaacattttggagaatgaatttacagtcagtgga
ctaacagaagatgctgcatacgaattccgtgtgattgccaaaaatgctgctggtgctatt
agcccaccatctgagccatcagatgctatcacatgcagggacgacattgaagcaccaagg
ataatggtggatatcaaatttaaggacacaattataataaaagcaggtgaagaattcaag
ctggaggctgatgtttcaggtcgcccacctccaacaatggaatggaccaaagatggaaag
gagcttgaaaacacagcaaaattagaaattaaagtggcagatttctctactaatctggta
aacaaggattcactaagaagggatggcggtgcctatacccttacagcaaccaatcctggt
ggttttgctaaacatattttcaatgtcaaagttcttgacagaccaggcccacctgaagga
cctttagctgtatctgaagtaacatcagaaaaatgtgtattgtcatggttgcctccactg
gacgatggaggtgccaaaattgaccattatgtagttcagaaacgtgaaaccagcagactg
gcatggacaaatgtagcttcagaagtccaagtaacaagactaaaggtcactaaactttta
aaaggcaatgaatacatattccgtgtgatggctgtaaataaatatggagttggagagcca
ctggaatcagagcctgtgcttgcactagatccttatggacctcctgatccacccaaaaat
cctgaagttacaactattactaaagattccatggttgtctgctggggacatcctgactca
gatggcggcagcgaaatcatcaattatattgtggaacggcgtgataaagctggccaacgc
tgggtgaaatgcaacagaaagactcttactgatttaagatataaagtgtctggactgaca
gaaggacatgaatatgagttccggatcatggctgagaacgctgctggaatcagcgcaccg
agtactaccagtccattttataaagcttgtgatgctgtgtttaaacctggcccgccaggt
aacccacgtgttctagatacaagcagatcatccatttcaattgcttggaacaaacctatc
tatgatggtggttccgaaatcactgggtatatggttgagactgccctgccagaagaagat
gaatggcatattgtcactccaccagccgggctcagggcaacttcttacactatcaccaac
ctcacagagaaccaggaatataaaatccgcatctatgccatgaattctgaaggcattggg
gaacctgcatttgttcctggaactccaaaggctgaagacaggatgctgcctccagagatt
gaactggacgctgaactgcgcaaagttgttaccataagagcttgttgtaccctgagactt
tttgttccaatcaaaggaaggccagtacctgaggtgaagtggacccgggagcacggagaa
tctttagataaagctagcattgagtccacaagctcttacaccctgcttatcgttggaaac
gtaaacagattcgacagtggcaaatacatactaactatagaaaacagctctggcagcaag
tctgcatttgtcagtgtcagagtactggatacaccaggccctccacaggatctgaaggta
aaggaggtcactaagacatctgtcacactgacatgggagcctcctcttcttgatggaggt
tcaaaaataagtaactatattgttgaaaagcgggaatcaacaaggaaagcatattcaact
gttgcaacaaattgccacaagacttcctggaaggtagaccagcttcaagaaggctgtagt
tactacttcagggttctcgctgaaaatgaatatggcatcgggctgcctgctgaaaccgca
gaatctgtgaaagcatcagaacgacctcttcctccaggaaaaataactttggtggacgtc
acaagaactagcgtgtcactctcttgggagaaacctgagcatgatggaggcagccgaatt
ctaggctacattgtagagatgcagagcaaaagcagtgacaaatgggccacatgtgccaca
gtcaaagtcaccgaagccactattactggattaattcagggtgaagaatactctttccgt
gtttctgctcagaatgagaagggcatcagtgatccgagacaactgagtgtgccagtagtt
gccaaggatcttgtcattccaccagccttcaaactcctgttcaatactttcactgtactg
gcaggtgaagatctgaaagtcgatgttccattcatcggacgccctacgccgactgcaacc
tggcataaagatgatgtaccactgaagcagacaaccagagtaaatgccgagagcacagaa
aataactcactactgacgataaaggaagcctgccgagaagatgttggacattacgtagtt
aaactgactaactcagccggtgaagctactgaaacccttaatgttattgttcttgacaaa
ccagggcctccaacaggaccagttaaaatggatgaagtgacagctgatagtatcactttc
tcctggggcccacctaagtatgatggtggaagctctatcagtaattacattgtagaaaaa
cgggacacttccacaaccacctggcagattgtgtcagctaccgttgcaaggacaacaata
aaagcttgcaggttaaagactggatgtgaatatcagtttaggattgcagctgaaaacaga
tatggaaagagtacctacctcaattcagagcctactgtagcccagtatccattcaaagtt
cctggccctcccggcacaccgttcgtaacgctctcctccaaggacagtatggaagtacaa
tggaacgagccagtcagtgatggaggtagcaaagtcattggctatcatctagaacgcaag
gagagaaatagcatcctctgggttaagttgaataagacacccattcctcaaaccaagttt
aaaacaactggcctcgatgaaggcattgaatatgaatttagagtctccgcacagaacatt
gttggcatcggcaagccaagtaaagtgtcagaaagctacgtagcccgtgatccatgtgat
ccaccaggaaggccagagccaatcattgtcacaaggaattctgtgacccttcagtggaag
aaacccacatatgatggtggaagcaaggtcactggttatattgttgagaagaaagaactg
cccgagggccgctggatgaaagccagttttacaaatgtcattgacactcagtttgaagta
actggcctagctgaagatcacagatatgagttccgggttatagctcgaaatgctgcagga
gtgtttagtgagccttcagaaagcacaggagcaataacagcaagagatgaggtagaacca
ccacgaattcgtatggatccaaaatacaaagacacaattgtggttcacgctggtgagtta
ttcaacattgacgcagatatttatggcaaaccagtaccagccactcagtggataaaaggt
gatcaggagctttcaaatacggctcgattagaaataaagagcactgattttgccaccagt
ctcaatgtaaaggatgcaatacgtgttgacagtggaaattacatactgaaagccaaaaat
gttgcaggagagatatcagtcactgtaaatgtcaaagttcttgacagaccagggccacct
gaaggacctattgttatatcaggagttacagcagaaaaatgcacactcacttggaaaccc
ccactacaagatggtgggagtgatatcatgaattatattgtggaaaagagagaaaccagc
cgcttggtttggactgtggttgatgccaacgtgcaaactctcagctgcaagcttactaag
cttcttgaaggcaatgaatatatcttccgtataatggctgtcaacagatatggtgttggc
gaacctcttgaatctgagccagtaattgtcaagaatccatttgtagtgccagatgcacca
aaagctccagaaatcacagcggtgaccaaggactcaatggttgttgtatgggaaaggcca
gcatctgatggtggcagtgaaattcttggatatgttcttgaaaaacgggataaagagggc
atcagatggacaagatgccataaacgtctgattggcgaactgcgcttgagagtaactgga
ctcttagaaaatcacaattatgaattcagagtctcagctgagaatgctgccgggctcagt
gaaccaagcccaccttctgcttaccaaaaggcttgtgatcctatttataaaccaggacct
ccaaacaatcccaaagtcattgatattaccagatcttccatcttcctttcttggggcaaa
ccaatatatgatggtggctgtgaaatccaaggatacattgttgaaaaatgtgacgtgagt
gttggtgaatggacaatgtgcactccaccgactggaatcaataaaacaaatatagaagtc
gagaagctgttggaaaagcatgagtacaacttccgtatctgtgccgttaacaaagttgga
gttggagaacatgccgatgtccctggacctattatagttgaagaaaaattggaagcacca
gacattgatcttgacctagaactaaggaaaattataaatataagggcaggcggctcctta
aggttatttgttcctattagaggtcgtcctacaccagaagttaaatggggaaaggtggat
ggtgaaatccgagacgcagctataatcgacagcactagcagcttcacctctcttgttctt
gacaatgtcaaccgatatgatagtggaaaatatactctcacgttagaaaacagcagtggg
acaaagactgcctttgttactgtgagagtcctggacacaccaagtccacctgttaatctg
aaagtcacagaaatcaccaaagactcagtatcaattacatgggaacctcctttgttggat
gggggatccaaaattaaaaactacattgttgagaaacgtgaagccacaaggaaatcatac
gctgcagttgtaacaaattgccataagaattcttggaaaatcgatcaactccaagaaggt
tgcagttactactttagagtcacagctgagaacgagtatggtattggccttcccgctcac
actgatgatccaattaaggttgcagaagtcccacagcctccaggaaaaataaccgtggat
gatgtcaccagaaacagtgtctctttaagttggacaaagcctgaacatgatggcggcagt
aaaatcattcagtatattgtggaaatgcaagctaaacaccgtgagaaatggtcagagtgt
gctcgagtcaagttccttgaagctgtaattaccaacctaactcagggagaagaatatctt
tttagagttgtggctgtaaatgaaaagggaagaagtgatcctaggtctcttgcagttcca
gtagttgccaaagatctggtcattgagccagatgtaagacctgcatttaacaattatagt
gtacaggttggccaagatttgaaaatagaagtgccaatttctggacgtcctaagccaacc
attacctggactaaagacggtcttccactgaagcagactacaagaatcaatgttactgat
tcacttgacctcaccatactcagtattaaagaaactcataaggatgacagtggacattat
ggaatcacagttgctaatgttgttggtcagaagacagcatccatcgaaattataacccta
gataagcctgatcctccaaaaggacctgttaaatttgatgaagtcagtgctgaaagtatt
accttatcttgggaacctccattatatacagggggctgccagatcactaactacatagtt
cagaaaagagatacaaccaccacagtatgggatgttgtttctgctactgttgccagaact
acactcaaagtgaccaaactgaagactggtacagaataccaattcagaatattcgctgaa
aacagatatggacaaagctttgccttggaatctgagccaattgtagctcaatatccctac
aaagaaccaggccctccaggcacaccatttgtcacagccatttccaaagactccatggtt
atacagtggcatgaaccaatcaataacggcggaagcccaatcataggttaccaccttgag
agaaaggaaagaaatagtattttgtggacaaaggtcaacaaaactattattcatgacacc
cagtttaaagcactcaatcttgaagaaggcattggatatgaattcagagtttatgctgaa
aatattgttggtataggcaaagcaagcaagaattctgaatgctatgtagccagagatccc
tgtgacccaccaggaaccccagaagcaataatagttaaaagacatgaaatcactttacaa
tggaccaaaccagcatatgatggtggaagtatgattacgggttacattgtagagaaacgt
gatttgcctgagggtcgttggatgaaagccagcttcacaaacgtcattgaaactcaattt
actgtgtcaggtcttactgaagatcaaagatatgaattcagagtcattgcaaagaatgca
gctggtacaataagcaaaccctctgacagtactggaccgataactgccaaggatgaggtc
gaactcccaagaatttcaatggatccaaaattcagagacacaattgtggtaaatgctgga
gaaacattcaggcttgaagctgatgtccacggaaagccactacccaccattgagtggtta
agaggagataaggaaattgaagaatctgctagatgtgaaataaataacacagatttcaag
gctttacttattgtaaaggatgccattagaattgatggtggacagtatattttaagagct
tccaatgttgcaggttctaagtcattcccagtgaatgtaaaagtgttagatagaccagga
cctccagaagggccagtccaggttactggagtcaccgctgaaaaatgcacattaacatgg
tctccaccacttcaagatggtggcagcaacatttctcactatgttgttgaaaagagagaa
acaagtcggcttgcctggactgttgttgcttcagaggttgtaaccaattctctgaaagtt
accaaactcttagaagggaatgaatatattttccgtataatggctgtcaacaaatacggt
gttggagagcctttggaatctgcaccagtactcatgaaaaatccatttgtgcttcctgga
ccaccaaaaagcctggaagtcacgaacattgccaaggactccatgaccgtctgttggaac
cgtccagatagtgatggtggaagtgagattattggctacattgtagaaaaaagagacaaa
agtggcattaggtggttaaaatgtaataaacgccgcattacagatttgcgtctaagagta
acaggattaacagaagaccatgagtatgaattcagagtttctgcagaaaacgctgctgga
gttggagaaccaagtccagctacagtttattataaggcttgcgatcctgtgttcaaacct
gggccccccatcaatgcacacattgtagacaccactaaaaattcatttacacttgcctgg
ggtaaacccatctacgatggtggcagtgagatcctgggatatgtagtagaaatctgtaaa
gcagatgaagaagaatggcaaatagttactccacagactggcctgagagccactcgattt
gaaatttcaaaactcactgaacaccaggagtataaaatacgagtctgtgccctcaataaa
gttggtttaggtgaggctacatcagttcctggtactgtgaaaccagaagataaactcgaa
gcacctgaacttgaccttgactctgagttaaggaaaggaattgttgtaagagctggtgga
tctgtcagaattcacattccattcaaaggttgcccaacacctgagatcacttggtctcga
gaggaaggtgaattcacagataaggtccaaactgaaaaagcagcaaactatacccaacta
tcaatagataactgtgatagaaatgatgctggaaaatatactctcaagctggaaaacagc
agtggatctaaatctgcctttataactgtgaaagttcttgacaccccaggaccactacag
aatttggcagtcaaagaagtgagaaaagattttgtccttctgatatgggaaccacccatc
atcgatgggggttcaaaggtcaagaactatgttattgacaaacgtgagtcaaccagaaaa
gcatatgctaatgtgagtaataaatgcagcaaaacaagctttaaagttgagaatcttaca
gaaggagccatgtactactttagagtaatggctgaaaatgaatttggagttggtgttcca
gtggaaaccactgatgctgtgaaagcagctgaacctccttccccaccaggaaaggtcaca
ctcactgacgtgtcccaaactagtgcatcgctgatgtgggagaaacctgaacatgatggt
ggtagcagaatcctggggtatgttgttgaaatgcagcccaaaggaacagaaaaatggagt
gttgtggctgaatccaaagtctgcaatgcagttgttactggtttgagttctggacaagaa
tatcagttccgtgtcaaggcttacaacgagaaaggaaaaagcgatccaagagtgcttggt
gttcctgtcatagccaaggacttgactatacagcctagttttaagttacaatttaacaca
tatagtgtccaagctggagaagatcttaaaatcgaaattcctgttattggccgaccgaga
cctgaaatttcatgggtcaaagatggcgagcctcttaaacagacaacaagagtaaatgtt
gaggaaacagctacctcaactattttgcacattatagaaagtaacaaagatgactttgga
aaatacaccataacagcaacaaatagtgcaggtacagcaacggaaaatctcagcattatc
gttttggaaaagcctggacctccagttggaccagttcggtttgatgaagttagtgcaacc
tttgtggtcatatcttgggaacctccagcctataccggtggctgccaaataagcaactac
attgtagagaagcgagatacaactaccaccacttggcacatggtatcagcaacagttgca
agaacaacaattaaaatacccaaactgaaaacaggcactgagtaccagtttagaattttt
gcagaaaacaggtatggaaaaagtgcccccttggattctaaaccagttattgtacaatat
ccatttaaagaacccggaccacctggcactccttttgtgacatcagtctcaaaagatcaa
atgcttgtgcagtggcacgagccagttaatgatggaggcagcaaagttattggctaccat
cttgaacagaaagaaaggaacagcattttatgggtcaaattaaataagactcccattcaa
gacaccaaattcaaaacaactgggcttgatgaaggccttgagtatgagttcaaagtttct
gctgaaaatatcgttggcatcggcaagccgagcaaagtgtcagaatgctttgttgcgcgt
gatccatgtgacccaccaggtcgccctgaagccattgttattacaagaaacaatgtcaca
ctgaaatggaagaaacctgcctatgacggtggcagcaaaataataggttatattgtagaa
aagaaagatctacctgatggccgttggatgaaagccagctttactaatgtattagaaact
gaatatacagtgagtggacttgtagaagaccaaagatatgaattcagagtaattgcaaga
aacgcagctggcaactttagtgaaccatctgaaagcactggagccattactgcaagagat
gaaattgatgcaccaaatgcctcactggatcccagatataaagatgtcatcgttgttcac
gcaggagacacttttgtccttgaagctgatatccgtggcacacctatacctgatattgtt
tggtcaaaagatggaaaagagcttgaagaaacagctgccagaatggaaattaagtctact
attcagaaaacaactgttcttgtcaaagactgtatacgtagtgacggaggacaatatatc
ctgaaactcagcaacgtgggtggtacaaagtctataccaatcactgtaaaggtacttgac
aggccagggcctcctgaagggcctctgaaagtttctggagttactgctgaaaaatgttac
ctggcatggaacccacctttacaagatggtggtgctaatatctcacattacatcattgaa
aagagagagacaagcagactctcctggacccaggtttcaactgaggtacagacccttaac
tacaaagtcactaaacttcttcctggtaatgagtacattttccgtgtcatggctgtgaat
aaatatggaattggagagcctctggaatctgagcctgttgtagcctgtaatccttataaa
ccaccaggtcctccttcaccacctgaagcctcagcaatcgccaaagagtctatggtcgta
acatgggcacgcccagtagatgatggaggtgctgaaatcgagggctacattcttgaaaaa
cgagataaggcaggcattagatggaccaagtgcaacaagaaaacactaacagatcttcga
ttcagggtgactggccttactgaagggcattcctatgaattccgagttgctgctgaaaat
gcagctggtgtgggtgaacctagtgagccatctgttttctatcgtgcatgtgatgctctg
tatccaccaggaccaccaagtaatctaaaagtgacagacacttccagatcttctgtctcc
ctggtatggaataagccaatttatgatggcggtgctcctgttaagggctatgttgttgag
gtcaaagaagccactgctgccgaatggacaatgtgcactccaccaacaggattacaagga
aagcagttcaccgtgaccaagcttaaagaaaatactgaatataacttccgtatttgtgcc
atcaattctgaaggcgtaggtgaacctgcaactatacctggttcagttgttgctaaagag
aggcaagagccaccagaaatagaactggatgctgatctccgaaaagtggtcattctgcgt
gcgagtgctactttacgcttatttgtcactatcaaaggtcgaccagaacctgaagttaaa
tgggaaaaggcagaaggcgttctcactgaccgggcccagattgaggtgaccagctcatat
acaatgttggtaattgataacgttaccagatttgacagtggtcggtataatctgacacta
gaaaataacagtggctctaaaactgtttttgttaacgtcagagttctcgactcaccaagt
gcccctgtgaatttgaccgtaggagaagtgaagaaagattcagtgacactggcttgggaa
ccaccgctgattgatggcggagctaagattacaaactacatcgtcgaaaaacgagaaact
acaagaaaagtgtatgctactgttacaaacaattgcacgaagaacacttttaaaattgaa
aacctgcaagaaggatgttcttactacttccgagtcttggcttccaatgaatatgggatt
ggtttgccagctgaaacaactgaacctgttaaagtttctgaaacaccccttccacctgga
agagtaactcttgttgatgtgacccgtaacacagctacaattaagtgggagagaccagaa
agtgatggtggcagcaaaattaccggttatgtagttgaaatgcagaccaaagggagtgaa
aaatggagcatctgcacacaagttaagactctagaagcaactatatctggcctaactgct
ggagaggagtatatcttcagggtagctgcacttaatgaaaaaggaaaaagtgatccaaga
caacttggagtgccagtaattgcaagagatgttgaaataaagccttcagttgagcttcct
ttcaatactttcaatgtaaaggctagagaccaactgaagattgatgttccatttaaagga
agacctcaagctactgtaagctggaaaaaagatggtcagactcttaaagagacaactaga
gtaaatgtttcttcttcaaagactataacatcactaacaattaaggaagcttcgagggaa
gatgttggaacttatgaattatgtgtttcaaacactgctggatccataacacttcctatt
actataattgtgcttgacaaaccaggacctcccggacctatacatattgatgaggttagt
tgtgacaatataaccgtttcttggaatcctccagaatatgatggtggctgccagattagc
aattacatcattgaaaagagagaaacctcttctacaacatggcacgtagtttcacaggca
gttgcaagaacatccattaaaatagttcgtctagtaacaggaagtgagtatcagttccgt
gtttgtgcagaaaaccgctatggaaagagctcctacagtgcatcttcagctgtagttgca
gagtatccattcagccccccaggtcctcctggtactcctaaagttgtccatgccacaaaa
tccaccatgttggtaacctggcaagtgccagttaatgatggaggaagtcaagtacttggc
tatcaccttgagtataaagaaagaagcagcattctttggtcaaaagcaaataagagcctc
atcactgatactcaaaagaaagtctccggccttgatgaaggactgatgtatgagtatcgt
gtatatgctgagactattgctggaattggtaaatacagtaagtcttgtgaaccagtccct
gcaagagacccttgtgaccctcctggacaacctgaagtcacaaatatcacaaggaaatca
gtgtcacttaaatggtctaaaccacattatgatggtggagctaagatcaccggatacatt
gtcgaacgtagagaactaccagatggccggtggctgaagtgcaactttactaatgtacaa
gaaacatactttgaagtagccgaacttactgaagatcagcgttatgaattccgggttttc
gcaaggaatgctgctgactcaactagtgagccatctgaatccactggacctatcacagtt
aaagacgatgttgaggctccaagaattatgatggatgtcaagttccgagatgttattgtt
gtcaaagctggagaggtccttaagataaatgcagacattgcagggcgacctctgccagta
atgtcctgggccaaggatggtgtagaaattgaagagagagcaagaacagaaattgtctca
acggactacaatactttgctaacagtgaaagactgtgtccgacgagactctggacagtat
gtgctaacactgaagaatgttgctggaactcggtctttggcagttaattgcaaggtactt
gataagcctggcccaccagcaggaccacttgaaataactggcctcactgctgagaaatgc
tctgtttcttggggaccgccccaagaagatggtggcgcagctatcgactattacattgta
gaaaaacgcgagacaagtcgccttgcttggacaatatgtgaaggagagttaaggacaaca
tcctgtaaagtgaccaagttgctcaagggcaatgaatacatctttagagtaaccggtgtt
aataaatatggtgttggcgagcccctggagagtgtggctgtaaaggcactagatccattt
acggttccaagtccacccacatctttggaaattacatctgtgaccaaagagttcatgaca
ctttgctgggcaagaccagagagtgatggaggcagtgaaatctctggatacataattgaa
aggcgagagaaaaacagcctacgatgggtgcgtgtaaacaaaaaaccagtttatgatctg
agagtgaaatcaacaggacttcgggaaggatgtgaatatgagtatcgggtatatgcagaa
aatgctgcaggcctgagccttccaagtgaaacctctcccttaattcaggcagaagatccc
gtgttcttaccatctcctccatccaaacccaatatcatggactcaggcaagaccaatata
actattggctgggttaagcccttatttgatggtgggtccccagtaactggatacactgta
gaatttaaaaaatctgatgaaactgactggaaaactgccattcagaacttaaggggcaca
gaatacacaataagtggactaaccacaggagccgaatacattttcagaataagatctatc
aataaggtcggtgctagtgatcccagtgatagctccgatccccagatagcaaaggaaaga
gaagaagaacctgtatttgatcttgacagtgaaatgaagaagaccttgatcgtcaaggcc
ggtgcctcttttaccatgactgtgcgtttccgaggaagaccagtacccagtgtctcctgg
agcaaaccagacactgacctccgcactagagcttatatcgattccacagagtctcgtaca
tcactgactattgaaaatgccaatagaaatgattctggaaaatacacattaacaattcag
aatattttgaatgctgcttcactgaccttagttgtcaaagttttagattctcctggtcct
ccagccaatattactgtacatgatgtcaccagagaatctgcagtgttatcctgggatgtt
cctgaaaatgatggtggagcaccagtgaagaattactacatagaaaaacgggaggccagt
aagaaagcatgggtctcagtgaccagcaactgtaaccgcctctcctacaaaattaccaac
ttacaagaaggggagatttactacttcagagtctccggagaaaatgagtttggtgttggt
gtaccagctgaaacgaaggaaggagtaaaaataacagaaaaaccaagcccacctgaaaaa
cttggagtaacaagtgtatccaaagatagtgtttccctggcctggttgaagccagaacat
gacggtggaagcagaattgtacattatgtcactgaagcactagaaaaaggacagaaaaat
tgggtgagatgtgcagtggtaaagtcaacccatcatgtcatttctggtctgagggagaat
tctgaatactttttccgggtgtttgctgaaaatcaagctggtctgagtgacccaagagag
cttctgcttcctgtccttgtaaaggagcagctagaaccacctgaaattgacatgaagaac
ttcccaagtcataccgtctatgttagagctggttcaaaccttaaagttgatattccaatt
tctggaaaaccactgcccaaagtgaccttatcaagagatggtgtcccgctgaaagcaacc
atgagatttaacactgaaattactgctgagaacctgaccatcaatctcaaagaaagcatt
gctgctgatgctggaagatatgagatcactgctgccaactccagtggaacaaccaaagct
ttcattaacatcatcatactggacaggcctggtcccgcaactggccctgttgtgattagt
gatgtaactgaagagagcgtgactctcaaatgggagccacctaagtatgatggtggaagt
caggttaccaattacattgtactcaagagagagacaagtactgcagtatggactgaagtg
tctgcgacagttgcaagaaccatgattaaagtcatgaaactgaccacaggagaagaatac
caattccgcatcaaggcagaaaaccgctttggcatcagtgatcacatagattcggcttgt
gtggttgtcaaactaccatacacaacacctggaccgccatctacaccatgggtcactaat
gtcactcgagaaagtatcaccgtgggctggcatgaaccagtgtccagtggcggcagtgca
gttataggctatcacctggaaatgaaagacagaaacactatcttatggcagaaagccaac
aaaatggtcatccgcaccactcacttcacagtcacaaccatcagtgctggacttgtctat
gaattcagggtgtatgcagaaaatgctgctggtattggaaaacccagccatccttcagaa
ccagtcctagccattgatgcctgtgaatccccaagaaatgtccgtatcactgatgtttca
aagaactctgtcaacctttcatggcaacaaccagcttttgatggaggaagcaagattaca
ggctacattgttgagagacgagaccttccagatggcagatggaccaaggccagcttcacc
aacgttaccgagactcaactcactgtctctggcttgactcagaattcccagtatgaattc
cgtgtctttgctagaaatgctgtcggttccatcagcaatccatctgaggttgcaggcccc
attacatgcatcgattcttatggtggacccataattgatttgcctctagaatatacagaa
gttgtcaaatacagagcaggtacatctgtgaagctcagagctggtatttctggcaaacct
gagcctacaattgagtggtataaagatgataaagagttacaaaccagtgcactgctgtgt
gtcgaaaataccactgaccttgcagctatactcatcaaagatgcaaatcgccttaacagt
ggaagctatgaattaaaactaaggaatgccataggctcagcctcagccaccatcagagtg
cagatccttgacaaaccaggacctccaggtggaccaattgaatttaagaccgtcactgct
acaaagataactcttctctggcagcctccagcggatgatggtggtgcaaaaatcactcac
tacatcgtggaaaagcgtgagacaagccgcgtcgtgtggtctatggtgtctgaaaatttg
gaagagtgcatcattacaaccaccaaaattatcaaaggaaatgaatacatcttccgggtt
cgcgctgtgaacaaatacggaattggtgatgcactggaatctcacccagtggtagcaagg
aatgcatttgtcacacctgggcctccgagcgtgccagaggtgacaaagataaccaagaat
tcaatgactgttgtctggaacaggccagttgcagatggtggtagtgacataagaggctat
ttccttgagaaacgagacaagaagagtctgggatggtttaaagtcctaaaggagacaatc
cgtgacaccagacagaaagtgacaggactcacggaacacagtgactatcaataccgagtt
tgtgctataaatgctgctggacagggtccattttctgaaccatctgacttctacaaagct
gctgatcctattgatcctccaggcccaccggctaagataagaattgaagattcaactaaa
tcatccatcactcttggctggagtaaaccggtctacaatgggggcagtgctgttactgga
tatgttgttggcatgagacaaggagaggaagaggaatggactgttgtctctacaaaagga
gaggtcagaactacagagtatgtggtatctaacctgaaacctggagtcaattactacttc
caggtatccgctgtaaactgtgccggacaaggggaacctatagaaatgactgaacccgta
caggccaaagatatacttgaggaaccagagatcgacctagatgtggctctcagggcctcc
attatagctaaagccggtgaagacgtacaagtgttgattcccttcaaaggcagacctcca
cctactgtcacatggagaaaagatgagaagaatcttggcagtgatgccagatacagcatt
caaaacactgattcatcttcattactcactattcctcaagtcactcgcaatgatatgggc
aaatatattctcacaatagaaaatggcattggtcagccaaagtcttcaactgtgagcgtt
aaagtgcttgatacaccagctgcctgccagaaactacagattaaacatgtttctcgaggc
acagtcacattgctctgggagtctcctctcattgatggaggatttcccataattaattac
atcattgagaagaaagatgccaccaagagaacatggtcttcagtgtcacacaaatgttct
agcacatcctttaaggtaacagatttgtcagagaaaactccattcttcttcagagttttt
gcagaaaatgaaattggaatcggggagccctgtgaaactacaaagccggtgaaggctgcc
gaagtaccagctcctatatgcgatctctcagtgaaagactcaacaaaaacatctgttacc
ctgagctggaccaagcctgactttgatggtggtagtgtcatcacagattatattgtggaa
aggaaaggtaaaggcgaacaaacatggtcacatgctggcataagtaagacatgtgaaatt
gaggttagccaactcaaggaactttcagtcctggaattcagagtgtctgccagaaatgag
aaaggactgagtgatggtgtcactattgggccaattacagtgaaagaacttgtaattcca
ccacaaattgacctgtcagaaatccctggggcacaagtcactgtgagaattgggcataat
gtgcacctcgagttaccttataaaggaaaacccaaaccatctatcagttggctgaaagac
ggtttgccattgaaagaaagcgaacgtgttcgtttgagtaaaactgaaaacaaactcact
ttgagtattaagaatgcaaagaaggagaatggagggaaatacaccattattctcgataac
gcagtttgtcgaaactcatttcccattacaatcatcacactcggcccaccatcaaagccc
aaagggcccattcgatttgatgaaatcaaggctgacagtgtcatcatatcatgggatgtg
cccgatgacgatggaggaggagaaattacctgttacagcattgagaagcgagaagcttca
caaactaattggaagatggtgtgttccagtgttgcccggacaactttcaaagttcctaat
ctagtcaaagatgctgaataccagtttagagttagggcagaaaacagatatggagtcagc
cagccacttgactcaaacatcattgtggcaaaacaccagttcaggattcctggcccccca
ggaaagccagttacatacaatgtgacttctgatggcatgtccctaacttgggatgcccca
gtttatgatggcggttcagaagttactggataccatgttgaaaagaaagaaagaaatagc
atcctgtggcaaagagttaacacatcgccaatatctggaagagaacatagagctactgga
ctaatggaaggcctggattaccagttccgtgtatacgctgaaaattctgccggcctaagc
tcacctagtgacccaagcaaatttaccttagctgtttccccagtagacccacctggcact
cctgactacattgatgtcacccgggaaaccatcactctgaaatggaacccaccactgcgt
gatggaggcagtaagatcgtggcctacaacatcgagaaacggcaagggagcgatcactgg
accagatgcaactttagtgatgtcagcgaatgccagtacacggcaacaggacttagtcct
ggggatcgatatgagttcagaatacttgcaagaaacgctgttggaaccataagcccgccc
tcacagtcttctggcgttattatgacaagggacgaaaatgttgcaccaattgtagagttt
ggccctgagtactttgacggtgtcactattaagtctggagaaagccttagaattaaagct
ttggtgcaaggacgaccagtacctcgagtaacttggttcagagatggagaggaaattgag
aagaggatgaatatggaaataaccaatgtccttggatccaccagcctctttgttagagat
gctactcgggaccatcgtggtgtatatagagtggaagccaaaaatgcatctggctccaca
aaagcagaaattacagtgaaagtacaagatacaccaggaaaaccagttgggccaataaga
ttcaccagtataactggcgagaagatgaccttgtggtggaatgctccactcaatgacggc
tgtgctcctgtatcgcactacatcattgaaaaacgggaaaccagcagacttgcttgggcg
ctaattgaggataattgtgaagccctcagctataccgccactaaactaataactggcaat
gaataccaattccgtatttctgcagtcaacaagtttggtgttggcaggccactggattct
gacccagtggttgctcaaatacagtacactattcccgattcccctggcactccagaacct
agtaatgtaacaggcaatagcatcaccctgacatgggcaaggccagaatcagatggtggc
agtgaaattcaacagtacatccttgaaaggagagaaaagaagagcacgcgatgggtgaaa
gtgatcagcaaacgaccaatctctgagacaagattcaaagtcaccggtctgacagagggc
aatgagtatgaattccatgtcatggctgaaaatgctgcaggagtaggacctgcaagtggt
atctcaacactaatcaaatgtagagagccagtcaacccaccaagtgctcccactgtggtc
aaagtgacagacacatcaaagacaactgtgagcttagaatggtctaagccagtgtttgac
ggagggatggagataatagggtatattattgaaatgtgcaaagctgacttaggagactgg
cacaaggtgaatgcagaaggatgtgtgaaaacaagatatacggttactgatctacaagca
ggtgaagaatacaaattccgggttagtgctgtcaatggtgctggaaaaggagacagctgt
gaagtgactggcaccattaaagcagttgaccgattatcagctcctgagttagacatcgat
gccaacttcaagcagactcatattgtgagagctggggccagtattcgcctcttcattgcc
tatcagggtagaccgactccgacagctgtgtggagcaaacctgactctaaccttagcatt
cgggctgatatccatacaacagactccttcagcaccctcaccgtggaaaactgcaaccga
aacgatgcagggaaatatacccttaccgtggaaaacaacagtggtagtaagtcaatcaca
ttcaccgtaaaggtgctagactctccaggcccacctggcccaattaccttcaaggatgtg
acccggggatctgttacattgatgtgggatgcccctctccttgatgggggtgcccgaatc
catcactacgtggtagagaaacgagaagccagtcgccgtagttggcaggtggtcagtgaa
aaatgcactcgtcagatcctcaaggtcaacgacctggtagaaggcgttccatactatttc
cgtgtttctgcagaaaatgagtatggtgttggtgaaccctatgaaatgccagaaccaatg
gtagccacagaacagcctgctccacctaagagacttgatgtcattgacacaagcaaatcc
tctgtggtcttagcttggcttaaacctgaccatgatggaggcagccgaatctctggctac
ctgctcgaaatgagacagaagggatctgacttctgggttgaagctggtcacaccaaacag
ctgactttcacggtggagcacctcactgagaacactgaatatgaattccgcgtgaaggcc
aagaatgatgctggctacggtgaacccagggaagccttctcttctgtcatcatcaaggag
cctcaaattgagcccacagctgatctcactggaattaccaatcagctcataacttgcaaa
gcaggcagcacatttaccattgacgtgccaatcagtggtcgtcccgcccctaaagtaaca
tggaagcttgaagaaatgagacttaaggagacagatcgagtgagtatcacaacaacaaaa
gacagaaccaccctgtctgtaaaggacagcatgagaggtgactctggaaggtacttcttg
accctggaaaatacagctggtgttaaaacatttaccatcacagttgtggtcatcggaagg
ccaggtccagtaactggccccattgaagtctcatctgtctcagctgaatcatgcatccta
tcatgggctgaacctaaagatgatggaggcaccgatattactaattacatagttgaaaag
cgtgagtcaggtacaacagcttggcagcttgtcaattccagtgtcaagcgcactcagatt
aaagtcactcatctcacaaaatacatggaatattctttccgtgtcagttcagagaacaga
tttggtgtcagcaagcctctggaatcagcaccaatcgttgctgagcatccatttgtccca
ccaagtgcacccaccagacctgaggtctactgtgtgtctgccaatgccatgtctattcgc
tgggaagaaccctatcatgatggtggcagtaaagtcatcggctactgggttgagaagaaa
gaacgtaacaccattctttgggtgaaagaaaacaaagtgccatgcttagagtgcaactac
aaagtgaccggtttggtagaaggactggaatatcagttcagaacgtacgcactcaatgtc
gcaggcgttagcaaagccagtgaagcatcaagacctatgatggctcaaaacccagttgat
gcaccaggaagaccagaggtgacagatgtcaccagatcaacggtgtcactgatttggtct
gccccagtgtatgatggaggcagcaaggttgtaggctacatcatagagcgtaagccagtc
agtgaagttggagatggtcgctggctcaagtgcaactacaccatcgtatctgacaatttc
ttcaccgttactgctctcagtgaaggagacacttatgaattccgtgtgttggccaagaat
gcagcaggcgtaattagcaaaggatcagaatctacaggccccatcacttgccgagatgaa
tacgctccacccaaagccgaactcgatgccagattacagggtgatctggttaccatcaga
gcaggctcggatcttgttctcgatgctgcagttggtggcaaacctgaacccaaaattatc
tggaccaaaggggacaaggaactagatctctgtgaaaaagtctctctgcagtacactggc
aaacgagcaactgctgtgatcaagttctgtgacagaagtgacagtggaagatacacttta
atggtgaagaatgccagtgggaccaaggccgtgtctgtcgtggtcaaagttctcgattcc
ccgggcccatgtggaaagctcaccgtcagcagagtaacagaggagaagtgcactttagcc
tggagccttcctcaggaagatggaggtgcagaaataactcactacatcgtggaaagacgt
gagactagcagactcaactgggtgattgtggaaggcgaatgcccaaccctatcctatgtg
gttaccagactcatcaagaacaacgaatacatattccgagtgcgggcagtaaacaagtat
ggccctggtgtgcctgttgaatcagagcccattgtcgccagaaactccttcactattcca
tcacaacctggcatacctgaagaagttggggctggcaaagagcatatcatcattcagtgg
acaaaacctgaatctgacggtggcaacgagatcagcaactatctagtagacaaacgtgag
aagaagagcttgcgctggacacgtgtgaacaaagaccatgtggtgtatgataccaggctg
aaggtgactggcctgatggaaggttgtgattaccagttccgggtgaccgcagtaaatgct
gctggtaacagcgaacccagcgaagcttccaactttatctcttgcagagaaccatcatat
acccctggaccaccttctgctccgagagttgtagataccaccaaacacagcattagttta
gcctggaccaagcccatgtatgacggtggcactgacatcataggatatgttcttgaaatg
caagagaaggacactgatcagtggtaccgagtgcataccaacaccacaataagaaataat
gaattcactgtgacagaccttaaaatgggccagaaatactccttcagagttgctgctgtg
aacgtgaagggcatgagtgaatacagcgagtcaactgctgaaattgagcccatggaaaga
ctagaaataccggatcttgagcttgcagatgatttaaagaagattgtgaccatcagagct
gggtcctcgttgcggctgatggtgtctgtatctggaagaccaccacccgtcaccacatgg
agcaagaagggcattgaccttgcaagccgggcgatcattgacaacactgagagttactct
ttacttattgtagacaaagttaaccggtatgatgctggaaaatacaccattgaagctgaa
aaccaatctggcaagaaatcagcaactgtccttgttaaagtatatgatactcctggtccc
tgtccttcagtgaaagttaaggaagtatcaagagattctgtgaccattacttgggaagtt
cccacaattgatggtggagctcctgtcaacaattacattattgagaagcgtgaagctgcc
atgagagcattcaaaacagtaactaccaaatgcagcaagacgctctacagaatttctgga
cttatagaaggaaccatgtactatttcagagtgctgccagaaaatatttatggcattgga
gaaccttgtgaaacatctgatgcagttctggtctcagaagtacctttggtgcctgtgaag
ctagaagttgtcgatgtcaccaaatcgactgttacccttgcctgggaaaaaccactctac
gatggtggtagccggctcactggctatgttcttgaggcctgcaaagctggcaccgagaga
tggatgaaggttgtcaccttaaaacccacagtcctagaacacactgttatttccttaaat
gaaggtgaacagtacttatttagagtaagggcacaaaatgagaaaggtgtgtcagaacca
agagagatcatcacagccgtgactgtacaagacctcagagtgttgccagcaatcgatctt
tctacaatgcctcaaaagaccatccacgtcccagccggcagaccagtagagctggtgata
ccaattgctggtcgcccacctcctgctgcttcctggttctttgctggctctaaactaaga
gaatcagagcgtgtcacagttgaaactcatactaaggtagctaaattaaccattcgtgaa
accactatcagagatactggagactatatacttgaactgaagaatgcaaccggaactact
tcagagaccattaaagttatcattctcgacaagcctggtccaccaactgggcctatcaag
attgaagaaattgatgctacttcagtgaccatttcctggggaccgcctgaactggatggt
ggtgctccactgagtggctatgtggtagaacaacgtgatgcccaccgtccagggtggctg
ccagtgtctgaatcagtgactagaacaacatttaagtttaccagactcactgaaggaaac
gagtatgtgttccgtatcgctgcgacaaaccgcttcgggatcggctcgtacttgcaatct
gaggccatagaatgtcgcagccgcatcaatattcctggacctccagaaacattacagata
tttgatgtctcacgtgagggcatgacacttacttggtacccaccagaagatgacggtggc
tcccaagtgactggatatattgtggagcgcaaagaagtgagagcagatcgatgggtccgt
gtaaataaagtaccagtgacaatgacacggtaccgttccactggccttattgaaggctta
gaatatgaacaccgtgtcacagccattaacgtgagaggaactggaaaaccaagccgtcct
tccaaacccaccattgccatggatccaattgctcctccaggaaagccacaaaacccaaga
gttactgatacaacaaggacatcagtctccctggcctggagtgttccagaagatgaagga
ggatctaaagtcacaggctacttgattgaaatgcaaaaagttgatcaatatgaatggacc
aaatgcaacaccaccccaaccaagattcgggagtatactctcacacacctacctcagggc
gctgaatacagattccgtgtcctagcttgtaatgctggtggacctggggagcctgctgag
gtaccaggaacagtcaaagtcacggaaatgcttgaatatcctgactatgaacttgatgaa
agataccaggaaggtatctttgtaagacaaggtggggtcatcagacttaccataccaatc
aaaggaaaaccattcccaatatgtaaatggaccaaggaaggccaagatattagtaagcgt
gccatgattgcaacctcggaaactcacactgagcttgtaatcaaagaagcagacagggat
gattctggcacttacgacctggttctggaaaacaaatgtggcaagaaggctgtctacatc
aaggtcagggtgataggaagtcccaacactccagaagggccacttgaatatgacgacata
caagctcgctctgtaagggtcagttggagaccccctgccgatgatggtggtgctgacatc
ttaggctacatcctcgagagacgagaagtgcctaaagccgcctggtacaccatcgactcc
agagtccgaggtacatctctggtcgtaaaaggcctcaaagaaaatgtggagtaccatttc
cgtgtttcagcagaaaaccagtttggaataagcaaacccttgaaatctgaggaaccagtc
ataccaaaaacaccactgaaccctcccgagcctccaagcaatcccccagaagtactagat
gtgaccaagagttctgtcagcctgtcctggtcccggcccagagacgatggtggttctcgg
gtcacaggctactacattgaacgcaaggagacatcaactgacaagtgggtcagacacaac
aagactcagatcaccaccacaatgtacaccatcaccgggcttgttcccgacgcggaatat
cagttccgcatcatcgcgcagaatgacatcggcctaagcgagaccagccctgcttctgaa
ccagttgtttgcaaagatccatttgataagccaagccaacctggagaactcgagattctt
tcaatatccaaagacagcgtcactctacagtgggagaaacctgaatgcgatggtggcaaa
gaaatccttggatactgggttgaatatagacaatctggagacagtgcctggaagaagagc
aataaggaccgcatcaaggacaggcaattcacaatagggggtttgctggaagctacagag
tatgaattcagggttttcgctgagaatgagacagggctgagcagacctcgaagaaccgct
atgtctgtaaggacgaaactaacgtctggagaggccccaggagtacgcaaagaaatgaag
gatgtcaccaccaaactgggtgaagctgctcaactgtcatgccagattgttggaaggcct
ctaccagacattaaatggtaccgatttggtaaggagctgatacaaagccgcaagtacaaa
atgtcttcagatggacgcacacatactctaacagtaatgaccgaggaacaagaagatgaa
ggcatttatacctgcgtagctaccaatgaagttggagaagtagaatccagtagcaagctt
ctcctgcaagcaatgccacaattccatcccggttacccactgaaagagaagtattacggt
gctgtggggtcaacgcttcgacttcacgttacatacattggccgtccagtacctgccatc
gcttggttccatggccagaaacttttgcaaaactcagaaaacattgctattgaaaatact
gagcagtatactcatctcgtcatgaagaatatccaacgtaagactcacgctgggaaatac
aaagttcagctcagcaatgttcttggaacggtggataccatccttgatgtggaaatacaa
gataaaccagacaaacctacaggaccaattgtgattgaagctctattgaagaactctgtg
gtgatcagctggaaaccacctgcagatgacggaggctcctggatcaccaattatgtggta
gagaaatgtgaggccaaggaaggggctgaatggcaattggtgtcttcagccatctcagtg
acaacctgtagaattgtgaacctaacagaaaatgctgggtattacttccgggtttcggct
cagaacacgtttggcatcagtgaccctctagaagtctcctcagttgtgatcattaagagt
ccatttgaaaagccaggtactcctggcaaaccaactattgctgctgtcacaaaagattct
tgtgttgtggcctggaagccacctgccagtgatggaggtgcaaagattagaaattactac
cttgagaagcgtgagaagaagcagaacaagtggattgctgtgacaacagatgaaattcga
gaaaccgtcttttcagtgcaaaaccttattgaaggtcttgaatatgagttccgtgtgaaa
tgtgaaaacctaggtggggaaagcgaatggagtgaaatatcagaacctatcactcccaaa
tctgatgtcccaattcaggcaccacactttaaagaggaactgagaaatctaaatgtcaga
tatcacagcaatgctactttggtctgcaaagtgactggtcatccaaaaccaattgtgaaa
tggtacagacaaggcaaagaaatcatcgcagatggattaaagtacaggattcaagagttt
aagggtggctaccaccagctcatcattgcaagcgtcacagatgatgatgccacagtttac
caagtcagagctaccaaccaaggagggtctgtgtctggcactgcctctttggaagtagaa
gttccagccaagatacacttgcctaaaaatcttgaaggcatgggagcagtccatgctctc
cgaggtgaggtaatcagcatcaagatcccattcagtggcaaaccagacccagtgatcacc
tggcagaaaggacaagatctcatcgacaacaatggccactaccaagttattgtcacaaga
tctttcacatcacttgttttccccaatggagtggagagaaaagatgctggtttctatgtg
gtctgtgctaaaaacaggtttggaattgatcagaagacagttgaactggacgtggccgat
gttcccgacccacccagaggagtcaaagttagtgacgtctcacgagattctgtcaactta
acatggactgagccagcttctgatggtggcagcaaaatcaccaactacattgttgaaaaa
tgtgcgaccactgcagaaagatggatccgcgtaggacaggcccgagaaacacactatacc
gtgatcaacttatttggaaaaacaagttaccagttccgtataatagcggaaaataaattt
ggcctgagcaagccttctgagccttcagaaccaaccataaccaaagaagataagaccaga
gctatgaactatgatgaagaggttgatgaaaccagggaagtttctatgaccaaagcatct
cactcttcaaccaaggaactctatgagaaatatatgattgctgaagatcttgggcgtggt
cagtttggaattgtccaccgttgtgttgaaacatcctcaaagaagacatacatggccaaa
tttgttaaagtcaaagggactgatcaggttttggtaaagaaagaaatttccattctaaac
atcgctaggcaccgaaatatcttatacctccatgaatcatttgaaagcatggaagaatta
gttatgatctttgagttcatatcaggacttgacatatttgaacgcattaacacaagtgct
tttgaacttaatgagagagaaattgtaagctatgttcgccaggtctgcgaagcacttgag
ttcttacacagtcataatattggacactttgacattagaccagaaaatatcatttaccaa
acaagaaggagctccaccattaaaatcatagaattcggtcaggcccgtcagctgaagcca
ggggacaactttaggcttctgttcactgcccctgaatactatgcacctgaagtccaccag
catgatgttgtcagcacagccacagacatgtggtcactcggaacactggtgtatgtgctg
ttgagtggtatcaatccattcctggccgaaactaaccaacaggtaattgagaacatcatg
aatgctgaatatacgtttgatgaagaagcattccaagagatcagccttgaagccatggac
tttgttgaccggctgttagtgaaagagagaaaatctcgcatgacagcatctgaggctctc
cagcacccgtggctgaagcagaagatagaaagagtcagtactaaagtgatcaggacattg
aaacaccgacgttactaccacgccctgatcaagaaagacctcaacttggttgtgtctgca
gccaggatctcctgtggtggtgcaattcgatctcagaagggagtgagcgttgctaaagtt
aaagtggcatccattgaaatcggcccagtttctgggcagataatgcatgcagtcgttgat
gaaggaggatatgtcaaatacgtatgcaaaattgaaaattacgatcagtctacccaagtg
acttggtactttggtgtcagacagctggagaacagtgagaaatatgaaatcacctatgac
gatggagtggccaccatgtatgtcaaagacattaccaaattcgatgacggtacctacaga
tgcaaagtagtcaatgactacggggaagacagttcttacgcagagctgtttgttaaaggt
gtgagagaaatttacgactattactgccgtagaaccataaagaaaattaagcgcagaaca
gacaccatgagactcctggaaaggccaccagaattcacactgcctctctataacaagaca
gtttatgtgggtgaaaatgtccggtttggagtaactataactgtccacccagagcctcga
gtaacatggtataaatcaggtcagaaaatcaaaccaggtgatgatgataggaagtacaca
tttgagtccgacaagggtctttaccaattaacaatcaacagtgtaactacggatgatgct
gccgaatacactgttgtcgcaagaaacaaatacggtgaagacagctgcaaagcaaagctg
actgtgaccccacacccacctccaacaggtacgaccctaagacccatgttcaaacggcta
ctggcaaacgcagaatgccaagaaggccaaagtgtctgctttgagatcagagtgtctggc
atccccccgccaacattaaaatgggagaaagacggtcagccactgtccctcgggcctaac
attgaaattatccacgaaggcttggattattatgctcttcatatcagggatactttgcct
gaagacacgggttactatagagtcacagccacaaacactgctggatccaccagctgccag
gcccacctacaagtggaacgcctgaggtatgtcaaacaggagttcaagactaaggaggag
cgtgaacgacacgtacagaggcaaattgacaagacactaagaatggctgaaattctttcc
ggaactgagactgtgccactgacacaggtcgcccaggaggcactgagagaagctgccatc
ctttacaaaccagccgtcagcaccaagactgtaaaaggggaataccgacttgagacggaa
gaaaagaaggaggagagaaaactccgcatgccttacgaagtaccagagccacgcaagtac
aaaccggacgccatagaagaagatcagcgcattaagcagttcgtgcccatgtctgacatg
aaatggtacaaaaagatacgcgatcaatttgaaatgcctgggaagatggacagagttgta
cagaaaagacccaagcgcatccgcctttcaagatgggaacagttctacgtgatgcctctt
ccacgcatcactgatcaatacagacccaagtggaggattcccaaactgtcccaagacgac
cttgaaatggtgagaccagcccgccagcatacaccttctcctgattattacttttattac
agacccaggagacgttctctcggtgacatctcggatgaagaattactcctgcccattgac
gactacctggcaatgaagagaacagaggaagagaggctgcgtcttgaagaagagctggaa
ctgggtttttcagcctcacccccaagccggagccctccacgttttgagctttcgagtctg
cgttacccttccccacaagctcacgtcaaggtggaggaagcaagaaaagacttcagatac
tcaacgtatcacatcccaacgaaggcggagaccagcatgagttacgcagagctgcgggag
cggcacgcccgcgcctcgcacaggcagcccaggcagcggcagaggatcatggccgagaga
gaggaccaagagctgctgcgtccagtcaccaccacccagcgcctctcggaatacaaaagc
gagctggaccacatggcgaaggaagaaaaatctagaaagaaatcaagacgccagagagaa
gtgactgaaataacggaaattgaggaagaatatgagatctccaaacactctcagagagac
acttcctcctcggtgtccaggctgctgagacgccggcgctccctgtctccgacctacatc
gagttgatgaggccggtgtccgagctgatccgaccacggccacagccagctgaggaatat
gaatatgaagatgacgtagaaagaaggtctcctaccccagagaggactcgcccacgttcc
cccagccctgtgtctagtgagcgttcactgtcaagatttgagaggtcagcaagatttgat
atcttttccaggtacgagtccatgaaagctgctttaaaaactcagaagacatcagaaagg
aagtatgaggttttgagtcagcagccttttacgctggaccacatgcctcgaatcacactg
aggatgcgctcccacagggtaccgtgcggccaaaatacacgttttatcttaaatgttcag
tctaagccaactgccgaagtcaaatggtaccacaacggtgtagaactccaagagagcagc
aagattcattacaccaacaccagtggggtcctgaccctggaaattctggactgtcatatt
gatgacggcggaacataccgtgccgtgtgcaccaactacaaaggtgaggcttctgactat
gcaaccttggatgtcacgggaggggattacaccacctatgcttcccagcgcagagacgaa
gaggtcccccgatctgttttccctgagctgacgagaacagaggcatatgcggtttcatca
tttaagaaaacatctgagatggaagcttcctcttccgtcagggaaatgaaatcacagatg
acagagacaagggaaagtctctcatcatatgaacactatgcatctgcagaaatgaaaagt
gctgcagtcgaagaaaagtcgctggaagaaaaatccacacacaggaaaatcaagacgact
ttggcagcaagaattctcacgaagccaaggtccataacggtgtatgaaggcgactctgca
aggttttcttgcgatacagatggtgagccggtaccaactgtgacatggctgcgtagggga
caagtcataagcacttccgcccgccaccaagtgaccaccacaaagtacaaatcaaccttt
gagatctcttcagtccaggcttcagatgagggcaactacagcgtggtggtagagaacagc
gaagggaagcaagaggcacagtttactctgaccattcaaaaggccagggttactgaaaag
gctctgacatcaccaccgaaagtcaaatccccagagcctcgggtaaaatccccagaagga
gtcaagtctccaaaacaagtgaaatccccagaaccggtgacttctcacccaaaagctgta
tcacccacagagacaaaacctacaccaacagaaaaggctcagcagctgccagtcactgcc
ccacccacgataattcagtccttgaaagcagaagcttctaaagatatagcaaagctgacc
tgtgtggtcgaaagtactgtattgtgtgcaaaagaggttgcctggtataaagatggtaag
aaactgaaggaaaatgggcatttccagtttcattattcggcagatggtacatatgagctc
aaaatccataacctcactgaatctgattgtggagaatatgtttgtgagatttctggtgaa
ggtggaacttccaaaactaacttccaatttgtgggacaagcctttaagaatatccatgag
gaagtttcaagcatatcagaaaccaagaaagcagctcagaaaactgctgagccagcagaa
accaagaaagcagctccaaaaactgctgagccaacagaaaccaagaaagcagctccaaaa
actgctgagccaacagaaaccaagaaaactgaaccaaaagctcctgaaccagtttccaca
aaaccagtaattgttactgggctgcaggatacaactatttcttcagacagtgtcactaaa
tttgcagttaaagctactggagaaccccagccgactgtcatctggacaaaggatggaaag
gctataacacaaggaggtaaatataaactctctgaagaaaaaggaggattcttcctagaa
attcataagactgatacttctgacggtggactttatacttgtacaataacaaattcagct
ggatctgtgtcctctagctgcaaattaacaataaaagctgtaaaagacactgagatacag
aaagtatctacacaaaagacttccaaaagtacatcccagaagaaggaagctgtccaagag
gaaatttccaaaaaagccctaatttctgaagaaatcaagatgtcagaggtgaaatctcct
gagaagttggccctcaaggaggaagcttcaacagttctgatttccgaaaaagtcaagaaa
tcagaagcgacctccctggaaaaatccattgtccatgaggaaatcactaaaacatcacag
gcatcagaagaaatcagaactcatgccgagatcaaagcatattctactcagatgagtata
cctgatggtcagaaagtgactttaaaagccaacattgctggtgccactgatgtgaaatgg
gtattgaatggggtagagctcagtaactccgaggagtacagatatggcgtctcaggcagc
gaccagacgctgaccatcaagcaggctggtcacaaagatgaagggatcctcacctgcatt
ggcaaaaccagccaaggaatcatcaagtgtcagtatgatctgaccctgagcaaagaactc
tcagatgctccagccttcatctcccagcccagatctcaaaatgttaacgaaggacaaaat
gttctcttttcttgtgaaatcagtggtgagccatcgcctgaaatcgaatggtttaaaaac
aacctgccaatttctgtttcttcaaatatcagtgtaagtcgctccagaaatgtatattct
cttgaaatccgaaatgcctcagtaagtgacagtgggaaatacacaattaaggccaaaaat
ttccatggccaatgttcagctactgcttccttaaccgtccttcctctagttgaagaacct
cccagagaggtagtattgaggacaagtggtgacacgagcttgcaaggaagcttctcatct
cagtcagtccaaatgtctgcctctaagcaggaggcctccttcagcagtttcagcagcagc
agtgctagcagcatgaccgaaatgaaatttgcaagcatgtctgcccaaagcatgtcctcc
atgcaacagtcctttgtagaaatgagttccagcagttttatgggaaaatctagtatgaca
caactggaaagctcaactagtaggatgcttaaagcaggcctaagaggaattccacctaaa
attgaagctcttccctctgacatcagcattgatgagggcaaagttttaacagtagcctgc
gcttttacgggtgagcctaccccggaaataacatggtgccatggtggaagaaaaattcaa
aatcaagaacagcaagggagattccatactgaaaacacagatgacctgacaactctgatc
atcatggacgtacagaaacaagatggtggactttataccctgagcttagagaatgaattt
ggatctgactctgctactgtgaatataaatattcgatccatttaa

DBGET integrated database retrieval system