KEGG   Physeter catodon (sperm whale): 102978888Help
Entry
102978888         CDS       T06011                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2 isoform X1
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00230  Purine metabolism
pcad01100  Metabolic pathways
pcad04022  cGMP-PKG signaling pathway
pcad04270  Vascular smooth muscle contraction
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04730  Long-term depression
pcad04921  Oxytocin signaling pathway
pcad04924  Renin secretion
pcad04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102978888 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    102978888 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102978888 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102978888 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102978888 (GUCY1A2)
   04924 Renin secretion
    102978888 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102978888 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    102978888 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    102978888 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102978888 (GUCY1A2)
Enzymes [BR:pcad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102978888 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Motif
Other DBs
NCBI-GeneID: 102978888
NCBI-ProteinID: XP_023971092
UniProt: A0A2Y9S0V1
Position
16
AA seq 757 aa AA seqDB search
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPPEPSAAAAATPTPAA
AAATAATAGARRAQRRRRVNLDSLGESISRLTAPSTQMIQQTLKRTLQYYEHQFTGYRDV
EKNFYNISNRCSYADHSNKEDIEDVSGILQCTANVLGLKFEEIQERFGEEFFNICFDENE
RVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGNLMLHYFHPHHIV
GFAMLGMIKAAGKKIYQLDVEVDQVANEKLCSDGSNPGNCNGLTFLIKQCENTHITKNLP
QGTSQVPADLRISINTFCRAFPFHLMFDPHMTVLQLGEGLRKQLRCDTHKVLRFEDCFEI
VSPKVNATFERVLLRLSTPFVIRTKPEASGTENKDKVMEVKGQMIHVSESNSILFLGSPC
VDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEE
KKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISML
NELYTRFDHQCGFLDIYKVETIGDAYCVASGLHRKSLCHAKPIALMALKMMELSEEVLTP
DGRPIQVSLSTVLFSFPTSIQQCLDRCYSQMELGTGRMRIGIHSGSVLAGVVGVRMPRYC
LFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIPRSREELPDNFPKEISGICY
FLEVRTGPKQPKPSLSSSRIKKVSYNIGTMFLRETSL
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaaggaagatttcgtcggagtccttcagctccctgggttccgactacctggag
acgagccccgaggaggagggggagtgccccttgtctaggctctgctggaacggcagccgg
agcccgcccgggccgcccgagcccagcgcggcggccgccgccaccccgaccccggcagcc
gccgccgctaccgccgccacggctggggccagaagagcgcagcgccggaggcgggtcaac
ctggactctctgggcgagagcatcagccgcctgacggcgccctcgacccagatgatacag
caaactctaaagaggacattgcagtattatgagcaccaatttactggttatagggatgta
gaaaagaatttctacaatatttctaacagatgctcctatgcagaccattccaacaaagaa
gacattgaagatgtctcaggaattcttcagtgtactgctaacgtactcggtttgaagttt
gaggaaattcaagaaagatttggtgaggagttctttaatatatgctttgatgagaatgag
agagtccttcgagctgtaggtggcacgttgcaggacttttttaatggctttgatgcattg
ttggaacacattagaacttcttttggaaaacaggccactctggagtcaccatcattccta
tgcaaagagctccctgaaggtaatcttatgctccactacttccaccctcaccacattgtg
gggtttgcaatgcttggaatgattaaggctgcaggaaagaaaatctatcagctggatgta
gaagtggaccaggttgcaaatgagaaactgtgctctgatggttcaaacccaggcaattgt
aatggtcttactttccttatcaaacaatgtgaaaatactcatatcacgaagaaccttcca
cagggaacctcccaagttcctgcggacctcagaattagcatcaacaccttctgcagagcc
ttccctttccatttgatgtttgacccccacatgacagtccttcaactgggggaaggccta
aggaagcagctccgatgtgacactcacaaagtgctcagatttgaggactgcttcgagatt
gtttctccaaaggttaatgccacctttgaaagggttctgctgcgactgtccacgccattt
gtgattaggaccaagcctgaggcttctggaactgagaataaagacaaggtgatggaagtt
aaaggacaaatgatccatgtctcagaatcaaattctattttattcttgggttctccatgt
gtggacaagttggatgaactcatgggacgagggctgcatctctcagacatccctatccat
gatgctacccgagatgtaattttggttggtgagcaggcaaaggcccaagatggcttgaag
aagaggatggataaattaaaagcaactttagaaagaactcaccaggccctggaggaagag
aaaaaaaaaacagtggatcttctatattctattttccctggtgatgtagcccagcaattg
tggcaagggcagcaagtgcaagccagaaagtttgatgatgtcaccatgctcttttcagac
attgttggcttcacagccatatgtgcccagtgtacccccatgcaagtaatcagcatgctg
aatgaactgtacacaagatttgaccaccaatgtggatttttggatatttataaggtggaa
acaataggtgatgcatactgtgttgcttcagggctccacagaaaaagcctctgccatgct
aaacccattgctctgatggccctgaagatgatggaactttctgaagaggtgctgacacct
gatggaagaccaattcaggtaagcctctcaacagttttgttttcatttcccacctcaatc
cagcagtgtttggataggtgttatagccaaatggagttgggtactggaagaatgagaata
ggcattcactcaggctctgtgctggctggagttgttggggtaagaatgccacgatattgc
ctgtttggaaataatgtcactctggcaagcaaattcgaatcgggaagtcaccctcgacgc
atcaatgtcagcccaaccacttaccaattattgaaacgagaagaaagtttcacattcatt
cctcggtcccgtgaagagcttccagacaactttccaaaggaaatctctgggatctgctat
ttcctggaggtaagaactggtccgaagcagccaaagccttctctttcttcatcgagaata
aaaaaggtttcctacaacattggcacaatgttcctccgggagacaagcctctga

DBGET integrated database retrieval system