KEGG   Physeter catodon (sperm whale): 102979222Help
Entry
102979222         CDS       T06011                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04024  cAMP signaling pathway
pcad04080  Neuroactive ligand-receptor interaction
pcad04713  Circadian entrainment
pcad04720  Long-term potentiation
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04728  Dopaminergic synapse
pcad04730  Long-term depression
pcad05014  Amyotrophic lateral sclerosis (ALS)
pcad05031  Amphetamine addiction
pcad05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    102979222 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102979222 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    102979222 (GRIA1)
   04728 Dopaminergic synapse
    102979222 (GRIA1)
   04720 Long-term potentiation
    102979222 (GRIA1)
   04730 Long-term depression
    102979222 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    102979222 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102979222 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    102979222 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    102979222 (GRIA1)
   05033 Nicotine addiction
    102979222 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcad04040]
    102979222 (GRIA1)
Ion channels [BR:pcad04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   102979222 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF659
Motif
Other DBs
NCBI-GeneID: 102979222
NCBI-ProteinID: XP_007109634
UniProt: A0A2Y9EX15
Position
8
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLSAILGQIVKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMVRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW
WYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASGGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgcc
gcttttagatttgctttgtcgcaactcacagagcccccaaagctgctcccccagattgat
attgtgaacatcagtgacagctttgagatgacctatagattctgttcccagttctctaaa
ggagtctatgccatctttgggttttacgaacggaggactgtcaacatgctgacctccttc
tgcggggccctccatgtctgcttcattacaccgagctttcctgttgacacatccaaccag
tttgtccttcagctgcgtcccgagctgcaggatgccctcatcagtatcattgaccattac
aagtggcaaaaatttgtctacatttatgatgctgaccggggtctgtccgtcctgcagaaa
gtcctagacacagcggccgagaagaactggcaggtgacagccgtcaacattttgacaacc
acagaggagggataccggatgctcttccaggacctggagaagaaaaaggagcggctggtg
gtggtggactgtgaatccgagcgcctcagtgctatcctgggccagattgtaaagctggag
aagaacggcattggctaccactatatccttgcaaatctgggtttcatggacattgactta
aacaaattcaaggagagtggagcaaatgtaacaggtttccagttggtgaactacacagac
accatcccggccaagatcatgcagcagtggaaaaacagtgatgctcgggaccacacccgg
gtggactggaagagacctaagtacacctctgcgctcacctacgatggggtgaaggtgatg
gctgaggctttccagagcctgcggagacagagaatcgatatctctcgccgggggaatgct
ggggactgcctggctaacccagctgtgccctggggccagggcatcgacatccagagagct
ctgcagcaggtgcggtttgaaggcttgacaggaaatgtgcaatttaatgagaaaggacgc
cggaccaactacaccctccatgtgatcgaaatgaagcacgacggcatccgaaagattggt
tactggaatgaagatgataagtttgtccctgcagccacggatgctcaagccgggggggat
aactcaagtgtccagaatagaacgtacatcgtcactacaatcctagaagatccttatgtg
atgcttaagaagaatgccaaccagtttgaaggcaatgaccgctacgagggctactgtgta
gagctggcagcagagattgccaagcatgtgggctactcctaccgtcttgagatcgtcagt
gatgggaaatatggagcccgcgaccctgacacaaaggcttggaatggcatggtgggagag
ctggtctatggaagagcagatgtggccgtggcccctttaactatcaccttggtccgggaa
gaggtgatagatttctccaaaccatttatgagtttggggatctccatcatgataaaaaag
ccacagaagtccaagccaggggtcttctccttcctggatcctttggcttatgagatttgg
atgtgtattgttttcgcctacattggagtgagtgttgtccttttcctggtcagccgcttc
agcccctacgaatggcacagtgaagagtttgaggaagggcgggaccagacaaccagcgac
cagtccaatgagtttgggatattcaacagcttgtggttctccttgggagccttcatgcag
caaggatgtgacatttctccaaggtccctgtccggccgcatcgttggcggcgtctggtgg
ttcttcaccttgatcatcatctcctcctacacagccaacctggccgccttcctgaccgtg
gagaggatggtatctcccattgagagtgccgaggacctagcgaagcagacagaaatcgct
tacgggaccctagaagcgggatccacgaaggagttcttcaggaggtctaaaattgccgtg
tttgagaagatgtggacgtacatgaagtcagcagaaccatccgtgtttgtgcggaccaca
gaggaggggatggtccgagtaaggaaatccaaaggcaaatacgcctaccttctagagtcc
accatgaatgagtatattgagcagcggaaaccctgtgacaccatgaaagtgggaggtaac
ttggattccaaaggctatggcattgcgacgcccaaggggtccgccctaagaggtcccgta
aacctagcggttttgaaactcagtgagcaaggcgtcttagacaagctgaaaagcaaatgg
tggtacgataaaggggaatgtggaagcaaggactccggaagtaaggacaagacaagcgct
ctgagcctcagcaatgtggccggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcgcgtagcgaatccaagcggatgaag
ggtttctgtttgatcccacagcaatccatcaacgaagccatacggacatcgacactcccc
cgaaacagcggggcaggagccagcggtggcggcagtggagagaacggccgggtggtcagc
catgacttccccaagtccatgcagtcgatcccctgcatgagccacagttcagggatgccc
ttgggagccaccggattgtaa

DBGET integrated database retrieval system