KEGG   Physeter catodon (sperm whale): 102979291Help
Entry
102979291         CDS       T06011                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glutathione S-transferase Mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00480  Glutathione metabolism
pcad00980  Metabolism of xenobiotics by cytochrome P450
pcad00982  Drug metabolism - cytochrome P450
pcad00983  Drug metabolism - other enzymes
pcad01100  Metabolic pathways
pcad01524  Platinum drug resistance
pcad05200  Pathways in cancer
pcad05204  Chemical carcinogenesis
pcad05225  Hepatocellular carcinoma
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102979291
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102979291
   00982 Drug metabolism - cytochrome P450
    102979291
   00983 Drug metabolism - other enzymes
    102979291
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102979291
   05204 Chemical carcinogenesis
    102979291
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102979291
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102979291
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102979291
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcad02000]
    102979291
Enzymes [BR:pcad01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102979291
Transporters [BR:pcad02000]
 Other transporters
  Pores ion channels [TC:1]
   102979291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 102979291
NCBI-ProteinID: XP_028341451
UniProt: A0A455BBV0
Position
Unknown
AA seq 212 aa AA seqDB search
MEMTLGYWDIRGLAHAIRLLLEYTDSKLEXEKYPMGDAPNYDRSQWLNEISKLGLDFPIL
PYLIDGAHKLTQSNAILRYIARKHNMCGETEEEKIRVDVLENQVMDVCLCMAMIRYSSDF
EKLKPDYLKEIPKTMKLFSDFLGKRPWFAGDKLTYVDFLAYDDVLDMHRIFEPKCLDEFP
NLKDFISRFELILLIPLVFISLFSSLSSLMLS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaccctgggttactgggacatccgcgggctggctcacgccatccgcctgctc
ctggagtacacagactcaaaactagaannggagaagtaccccatgggggacgctcccaat
tatgacagaagccagtggctgaatgaaatatccaagctgggcctggacttccccattctg
ccctacttaattgatggggctcacaagctcacccagagcaacgccatccttcgctacatt
gctcgcaagcacaacatgtgtggggagacagaggaagagaagattcgcgtggacgtattg
gagaaccaggttatggatgtctgcttgtgcatggccatgatccgctacagctctgacttt
gagaaactaaagcctgattacttgaaggagatccctaaaacgatgaagctcttctcagat
tttctggggaagaggccctggtttgcaggggacaagctcacctatgtggatttcctggct
tacgacgatgtccttgacatgcaccgcatatttgagcccaagtgcctggatgaattccca
aacctgaaagacttcatttcccgttttgagctgattctcctgatccctctagtatttata
tctctcttctcttccctctcttcactgatgctttcctag

DBGET integrated database retrieval system