KEGG   Physeter catodon (sperm whale): 102979339Help
Entry
102979339         CDS       T06011                                 

Gene name
NOP58
Definition
(RefSeq) nucleolar protein 58 isoform X1
  KO
K14565  nucleolar protein 58
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    102979339 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pcad03009]
    102979339 (NOP58)
Ribosome biogenesis [BR:pcad03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    102979339 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT tRNA-synt_His
Motif
Other DBs
NCBI-GeneID: 102979339
NCBI-ProteinID: XP_007117841
UniProt: A0A2Y9F9V5
Position
2
AA seq 537 aa AA seqDB search
MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAF
TALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPLVNELMRGIR
SQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAISLLDDLDKELNNYI
MRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASATLSELLPEEVEAEVKAAAEI
SMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIA
HAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHASLVGQTSPKHKGKISR
MLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRTLEDRGIRKISGTGKALAKAEKYE
HKSEVKTYDPSGDSTLPTCSKKRKIEQVDKEDEVVEKKAKKAKVKIKVEEEEEVVEVEED
VVEVVEEQETSVKKKKKKDKKKHIKEEPLSEEEPCTSTAIASPEKKKKKKKKRVNED
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgctgtttgaaacgtccgtcggctacgccatctttaaggttttgaatgaaaag
aaacttcaagaggttgatagtttgtggaaagaatttgaaactccagagaaagcaaataaa
atagtaaagctgaaacactttgagaaatttcaggatacagcagaggcattggcagcattc
acagctctgatggagggcaaaatcaataagcagctgaagaaagttctgaagaaaatagtt
aaagaagcccatgaacccctggctgtagctgatgctaagctaggaggagtcataaaggaa
aagctgaatctcagttgtatccatagtcctcttgttaacgaacttatgagaggaatccgt
tcacagatggatggattaatccctggggtagaaccacgtgaaatggcagccatgtgtctt
gggttggcacacagcttgtccagatacagattgaaatttagtgctgataaagtggataca
atgattgttcaggcaatttccctgttagatgacttagataaagaactaaacaactacatt
atgcggtgtagagaatggtatggctggcatttccctgaattaggaaaaattatttcagat
aatttgacatactgcaagtgtttacagaaagttggcgataggaagaattatgcctcggcc
acgctttctgaattactaccagaagaggttgaagcagaagtgaaagcagctgcagagata
tctatgggaacagaggtttcagaagaagatatttgcaacattctgcatctctgcactcag
gtgattgaaatctccgaatatagaacccagctctatgaatatctgcagaatagaatgatg
gccattgcacccaacgttacagtcatggttggtgaattagttggagcacggcttattgct
catgcaggttctcttttgaatttggccaaacatgcagcttctacagttcagattcttgga
gcagaaaaggcactcttcagagccctcaagtctagacgagatactcctaagtatggtctc
atttatcatgcttcacttgtaggccagacaagtcccaaacacaaaggaaagatttctcgg
atgctggcagccaaaactgttttggccatccggtatgatgcgtttggtgaagattccagt
tctgcgatgggaattgagaacagagccaaattagaggccaggttgagaaccttggaagat
agagggatacggaaaataagtggaacaggaaaggcattagcaaaagcagaaaaatatgaa
cataaaagtgaagtgaagacttacgatccttctggtgactccacactgccaacctgttct
aaaaaacgaaagattgaacaggtagacaaagaggatgaagtggttgaaaagaaggccaaa
aaagccaaggttaagattaaagttgaagaagaggaggaagtagtagaagtagaagaagat
gtagtagaagtggtggaagaacaggagacatctgtgaagaaaaagaagaaaaaggacaaa
aagaaacacattaaagaagaaccgctttctgaagaagaaccatgcaccagcacagcaatt
gctagtccagagaaaaagaagaaaaagaaaaaaaaaagagttaatgaggactaa

DBGET integrated database retrieval system