KEGG   Physeter catodon (sperm whale): 102979394Help
Entry
102979394         CDS       T06011                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase F, mitochondrial
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04020  Calcium signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad05012  Parkinson disease
pcad05016  Huntington disease
pcad05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102979394
   04022 cGMP-PKG signaling pathway
    102979394
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102979394
   05016 Huntington disease
    102979394
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102979394
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pcad03110]
    102979394
Enzymes [BR:pcad01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102979394
Chaperones and folding catalysts [BR:pcad03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    102979394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 102979394
NCBI-ProteinID: XP_028339334
UniProt: A0A455AT82
Position
Unknown
AA seq 122 aa AA seqDB search
HPSASSGGDISADALCSQAGDFTNHNGTGGRSIYGSRFPDENFKLKHKGPGVLSMANAGP
NTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESLGSKSGKTSKKIVITDCGQHA
ES
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
cacccctctgccagctctggtggcgacatctcagccgatgctctgtgctcgcaggccggt
gacttcaccaaccacaacggcacaggggggaggtccatctacgggagccgctttcctgac
gagaacttcaaactgaagcacaaggggccaggtgtcctgtccatggcaaatgcaggcccc
aacactaacggctcccagttcttcatctgcaccataaagacagactggctggatggcaaa
catgttgtgtttggtcatgtcaaagagggcatggatgtagtgaagaaaatagaatctctt
ggctccaagagtgggaagacatccaagaagattgtcatcacggactgtggccagcatgcg
gaatcttag

DBGET integrated database retrieval system