KEGG   Physeter catodon (sperm whale): 102979768
Entry
102979768         CDS       T06011                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102979768
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     102979768
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 102979768
NCBI-ProteinID: XP_028342517
UniProt: A0A455B171
Position
Unknown
AA seq 324 aa
MCWLLVSXEALHHVAVTRATHSNETASAYLARHWLRVPGEVXRLSFSTVPVLLANPVASA
ACCRCVGYDLSRAFTGSFLNARANPDDPHEVSRARDLNQLLGPKASSPPSTYPRPSQHHG
FTWKAPTTFITCTCATTSRWPYGGGRRVRASTLRTRRERPWSCAAAPRVLRANLFTRMRV
VVAAAVDFIELFKRSPGSYPASCTGMEMEAYGTASSVDFPCTEAGDLAGTVHPQLRDXDF
EPPRPGAPIFQMFSSEDVLYEGGSTMDPVFINEVAYYEEGTAFLQTEKLALSVPALPTLA
STLPGPLIQATPAQPQPSLLNSGS
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtgctggctgctggtgtcctgagaggccctgcaccacgtggcagtgaccagggccact
cacagcaatgagacagctagcgcctacctggcccggcactggctgcgggtcccaggggag
gtgnncagactcagcttctccaccgtgcctgtgctgctggccaacccggtggcctcagcc
gcctgctgccgctgcgtgggctatgacctcagtcgtgccttcaccgggtccttcctaaat
gccagggccaacccagatgacccacacgaggtgtcaagggccagagacctgaaccagctg
ctggggcccaaggcctcgagcccgccttctacttatcccagaccttcacaacaccacggc
ttcacctggaaggcacctacaacgtttataacatgcacctgtgccaccacctccaggtgg
ccctatggcggggggaggagagttagagcgagcacactgcgaacaagaagggagaggccc
tggagctgcgccgcggccccaagggtgctgcgggccaaccttttcaccaggatgagggtc
gtggtggccgcagctgtagacttcatcgagctgttcaagagatccccggggtcttaccca
gcctcctgcacaggcatggagatggaagcatatggaaccgcgagcagcgtggacttccca
tgcaccgaggccggggacctggccggcaccgtgcatcctcagctgcgggactgagacttc
gagccaccgcggcctggcgcacccatcttccagatgttcagcagtgaggacgtgctctat
gagggggggtccaccatggaccctgtgttcatcaacgaggttgcctactacgaggagggc
actgccttcctccagactgagaagctcgcgctctccgtgcctgccctgcccacactggcc
tccaccctgccagggcccctaatccaggccacacccgcccagcctcagccctcccttctg
aacagtgggtcgtga

DBGET integrated database retrieval system