KEGG   Physeter catodon (sperm whale): 102980545Help
Entry
102980545         CDS       T06011                                 

Gene name
ACAT2
Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00071  Fatty acid degradation
pcad00072  Synthesis and degradation of ketone bodies
pcad00280  Valine, leucine and isoleucine degradation
pcad00310  Lysine degradation
pcad00380  Tryptophan metabolism
pcad00620  Pyruvate metabolism
pcad00630  Glyoxylate and dicarboxylate metabolism
pcad00640  Propanoate metabolism
pcad00650  Butanoate metabolism
pcad00900  Terpenoid backbone biosynthesis
pcad01100  Metabolic pathways
pcad01200  Carbon metabolism
pcad01212  Fatty acid metabolism
Module
pcad_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    102980545 (ACAT2)
   00630 Glyoxylate and dicarboxylate metabolism
    102980545 (ACAT2)
   00640 Propanoate metabolism
    102980545 (ACAT2)
   00650 Butanoate metabolism
    102980545 (ACAT2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102980545 (ACAT2)
   00072 Synthesis and degradation of ketone bodies
    102980545 (ACAT2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102980545 (ACAT2)
   00310 Lysine degradation
    102980545 (ACAT2)
   00380 Tryptophan metabolism
    102980545 (ACAT2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    102980545 (ACAT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102980545 (ACAT2)
Enzymes [BR:pcad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     102980545 (ACAT2)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102980545 (ACAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-GeneID: 102980545
NCBI-ProteinID: XP_007126079
UniProt: A0A2Y9FLA0
Position
Unknown
AA seq 397 aa AA seqDB search
MSADSDPVVIVSAARTIIGSFNGALSTVPVYDLGSTVIREVLKRAAVAPEEVSEVIFGHV
LAAGCGQNPVRKASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIVVGDSSIVVAGGME
NMSKAPHLVHLRTGVRMGDTPLTDSMLCDGLTDAFHNYHMGITAENVANKWQVSREDQDK
VAVLSQNRTESAQKAGHFDKEIVPVFVSSKKGLTEVKTDEFPRHGSNMEAMSKLKPCFLT
DGTGTVTPANASGINDGAAAVVLMKKSEADNRGLTPLAQIVSWSQAGVEPSIMGIGPIPA
IKQAVAKAGWSLEDVDVFEINEAFAAVSVAIAKELGLNPEKVNTEGGAIALGHPLGASGC
RILVTLLHTMERKGGHRGVAALCIGGGMGIAMCVLRG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagactcagaccccgtggttattgtctcggcggcgcggaccatcataggctcc
ttcaatggtgccttatccaccgttcctgtctatgacctgggctcaactgtcatcagagag
gtcctgaaaagggccgctgtggctcccgaagaggtatcagaggtcatatttggacacgtt
ttggcagcaggttgtgggcagaatcctgttcgaaaagccagtgtgggtgccggaatcccc
tactctgttccagcatggagctgccaaatgatctgtgggtcaggcctaaaagccgtgtgc
cttgcagcccagtccatagtggtaggagactccagcattgtggtcgcaggaggcatggaa
aacatgagcaaggctcctcacttggttcacttgaggacaggagtccggatgggggataca
ccactaactgacagtatgctctgtgatgggcttacagatgcatttcacaactatcatatg
ggcattacagctgaaaatgtagccaacaaatggcaagtgagtagagaagatcaggacaag
gttgcagttctgtcccagaacaggacagagagtgcacagaaagctggccattttgacaaa
gagattgtaccagtttttgtatcttctaaaaaaggtcttactgaagttaaaacagatgag
tttcctcgccacgggagcaacatggaagccatgtctaagctaaagccttgcttccttaca
gatggaacaggaacagtcaccccagctaatgcttcaggaataaatgatggtgccgcagct
gtggttcttatgaagaagtcagaagctgataaccgtgggcttacacccctagcacagata
gtttcctggtcacaagcaggtgtggagccttccattatgggaataggaccaattccagca
ataaagcaagctgttgcaaaagcaggttggtcgctggaggatgttgacgtatttgaaatc
aatgaagcctttgcagccgtctctgttgcaatagctaaagaacttggattaaacccagag
aaggtcaacactgaaggaggagctatagccctgggccatcctcttggagcatctggctgc
cggattcttgttaccctgttacacacgatggagcgcaagggtggacatcgtggtgttgct
gccctatgcattgggggtgggatgggaatagcaatgtgtgttctgagaggatga

DBGET integrated database retrieval system