KEGG   Physeter catodon (sperm whale): 102984239Help
Entry
102984239         CDS       T06011                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00564  Glycerophospholipid metabolism
pcad00565  Ether lipid metabolism
pcad00590  Arachidonic acid metabolism
pcad00591  Linoleic acid metabolism
pcad00592  alpha-Linolenic acid metabolism
pcad01100  Metabolic pathways
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04217  Necroptosis
pcad04270  Vascular smooth muscle contraction
pcad04370  VEGF signaling pathway
pcad04611  Platelet activation
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04724  Glutamatergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04921  Oxytocin signaling pathway
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102984239 (PLA2G4E)
   00565 Ether lipid metabolism
    102984239 (PLA2G4E)
   00590 Arachidonic acid metabolism
    102984239 (PLA2G4E)
   00591 Linoleic acid metabolism
    102984239 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    102984239 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102984239 (PLA2G4E)
   04010 MAPK signaling pathway
    102984239 (PLA2G4E)
   04370 VEGF signaling pathway
    102984239 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    102984239 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102984239 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102984239 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    102984239 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    102984239 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102984239 (PLA2G4E)
   04913 Ovarian steroidogenesis
    102984239 (PLA2G4E)
   04921 Oxytocin signaling pathway
    102984239 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102984239 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    102984239 (PLA2G4E)
   04726 Serotonergic synapse
    102984239 (PLA2G4E)
   04730 Long-term depression
    102984239 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102984239 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102984239 (PLA2G4E)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102984239 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 102984239
NCBI-ProteinID: XP_023974053
UniProt: A0A2Y9S693
Position
11
AA seq 869 aa AA seqDB search
MLQKQMLVSVSHNPSHPSQEEDGRPSATCTLEEELSPCHLLTVRVIRMKNVRQADVLSQT
DCFVSLWLPTTSKKRLRTRTISNCRNPEWNETFKFQIQTQVKNVLELSICDEDTVTPDDH
FLTVLYDLTKLCFREKTHVKFPLNTEGMEELEVEFLLEESPSPPESLITNGVLVSRQVSC
LEVHAESRRQTNRKMKDLLVTVTESFEHTQHISHCLDPCHPNSACFHYPKYFQPQVHVEV
PKSQWSSSVDGRGSRGLGAGPDGRREEPLPSQNHPSFQLSCCGAYKNGPVCQPLDCLRDG
QAVTLPVSKNCELHMKSTPCSEALDVRLGFSLCQAELEFLQKRRVVVAEALKQVLQLEED
LQADEVPLIAIMATGGGTRSMTAMYGHLLGLQKLNILNCASYITGLSGATWTMATLYRDP
DWSSKNLELAILEARRHVVKDKMPALFPDQLLKFQKELQQRRQEGYKVTFTDFWGLLVEA
CLGDERNECKLSDQSAALCQGQNPLPIYLTVNVKDDISNQDFREWFEFSPYEVGLPKYGG
FIPTELFGSEFFMGRLMRRIPESRMCYMLGLWSSIFSLNLLDAWNLSHNSEEFFHRWTRE
RVHDIEDEPHLPEIPKCDANILDTTVVMPGSWLSNTFRNILTYRAFVSEFHNFLLGLQLH
TDYHQNGQFATWKDTVLDGFPNQLTGSVNHLCLLDTAFVINSSYPPILRPERKADLIIHL
NYCAGSQTKPMKQTCKYCTEQNIPFPKYEVQEEDDNLKECYLLENSQEPNAPIVIFFPLI
NDTFQKYKAPGVERSPEELEQGQVDIYGPKSPYTTKELTYTEAAFDKLVKLSEYNILNNK
DKLLQALRLAVEKKKRLKSQCPPKVPGHP
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagaagcagatgcttgtctcagtctcccacaacccgtcacacccaagccaagaa
gaagatggcaggccctccgccacctgcaccttggaggaggagctgtctccatgccacctg
ctgacagtgagggtcatccggatgaaaaacgtccgacaggctgacgtgttaagccagaca
gactgctttgtgagcctctggctgcccaccacctctaaaaagaggctgaggactaggacc
atctccaactgccgaaacccagagtggaatgaaaccttcaagttccagatccagacccaa
gtgaagaacgtgctagagctgagcatctgtgatgaagacacggtgacaccagatgaccat
ttcttgacagttctctatgacctcaccaagctctgcttccgagagaaaacccatgtgaag
ttcccactcaacacagagggcatggaggagctggaggtggagttcctgctggaggagagc
ccctctccacctgagagtctcatcaccaatggcgtgctggtgtctcgacaagtgtcctgc
ctggaggttcatgcagaatccaggagacagacgaataggaaaatgaaggacctcctggtg
acagtgacggagtccttcgagcacacccagcacatctcacactgcctggatccctgccac
ccaaactctgcctgcttccactaccccaagtacttccagccccaggtccacgtggaggta
cccaaaagccagtggagctcttcggtagacggccgcggcagtagggggttaggggctggt
ccagacgggcgtcgggaggagcccctcccctcacaaaaccacccatccttccagctttcc
tgctgcggtgcgtacaagaacggtcctgtgtgccagcccctggattgcctgcgtgacggc
caggcggtgaccctgcctgtgagcaagaattgtgaattacacatgaagtctacaccctgc
tccgaggcactggacgtgcggctgggcttcagcctgtgccaggcagagctggagttcctg
cagaagcggagggtggtggtggctgaggcgctgaagcaggtgttgcagctggaggaggac
ctgcaggcagacgaggtcccactgatagccatcatggccactgggggtggaacaagatcc
atgactgccatgtatggccacctgctggggctgcagaagctgaacatcctgaactgtgcc
agctacatcactggcctgtcaggggccacctggaccatggctaccttgtaccgtgaccct
gactggtcctccaaaaacctggagcttgccatccttgaggcacggaggcacgtagtcaag
gacaagatgcccgctctgttcccagatcagctcctcaaattccagaaggagctgcagcag
cgcaggcaggaaggctacaaagtcaccttcacagacttctggggcctgctggtcgaggcc
tgtctgggggacgagagaaatgaatgcaaactgtcagatcagagtgctgctttgtgccag
ggccagaaccccctgcccatctacctcaccgtcaatgtcaaggatgatataagcaaccag
gatttcagagagtggttcgagttctccccctacgaggtgggcctgccgaagtatggaggc
ttcattcccaccgagctcttcggctccgagttcttcatggggcggctgatgaggaggatc
ccagagtcgcggatgtgctacatgctaggtttgtggagcagcatcttctccctgaacctg
ctcgatgcctggaatttgtcccacaactcggaagagtttttccacaggtggacaagggag
agagtgcatgatatcgaagacgagccacacctacctgaaatccccaaatgtgatgccaac
atcctggacaccacggtggtgatgccagggtcatggctgtccaatactttccgcaacatc
ctcacctaccgggcctttgtgtctgagttccacaacttcctgctggggctgcagctgcac
accgactaccaccagaatggccagttcgccacgtggaaagacacggtgctagatggcttc
ccaaaccagctgacagggtccgtgaaccacttgtgcctgctggacactgcattcgtcatc
aactccagctacccgcccatcctcaggccggagagaaaagctgacctcatcatccacctc
aattactgtgctgggtcccagacaaagcccatgaaacaaacctgcaagtactgcaccgag
cagaacatccccttccccaaatatgaggtgcaggaggaggatgataacctcaaggagtgc
tacctgctggagaactcccaggaacccaatgcccccattgtgattttcttcccactcatc
aacgacaccttccaaaagtacaaggccccaggtgtggagcgaagccccgaggagctggag
cagggccaggttgacatctatggtcccaaatctccctacaccaccaaggagctgacatac
acggaggccgccttcgacaagctggtgaagctctccgaatataacatcctgaataacaag
gacaagctccttcaggccttgcgactggcagtagagaagaagaaacgcctgaagagccag
tgtccccctaaagtcccaggacacccctaa

DBGET integrated database retrieval system