KEGG   Physeter catodon (sperm whale): 102985111Help
Entry
102985111         CDS       T06011                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2 isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00564  Glycerophospholipid metabolism
pcad00565  Ether lipid metabolism
pcad00590  Arachidonic acid metabolism
pcad00591  Linoleic acid metabolism
pcad00592  alpha-Linolenic acid metabolism
pcad01100  Metabolic pathways
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04217  Necroptosis
pcad04270  Vascular smooth muscle contraction
pcad04370  VEGF signaling pathway
pcad04611  Platelet activation
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04724  Glutamatergic synapse
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04750  Inflammatory mediator regulation of TRP channels
pcad04912  GnRH signaling pathway
pcad04913  Ovarian steroidogenesis
pcad04921  Oxytocin signaling pathway
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102985111 (PLA2G4A)
   00565 Ether lipid metabolism
    102985111 (PLA2G4A)
   00590 Arachidonic acid metabolism
    102985111 (PLA2G4A)
   00591 Linoleic acid metabolism
    102985111 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    102985111 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102985111 (PLA2G4A)
   04010 MAPK signaling pathway
    102985111 (PLA2G4A)
   04370 VEGF signaling pathway
    102985111 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    102985111 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102985111 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102985111 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    102985111 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    102985111 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102985111 (PLA2G4A)
   04913 Ovarian steroidogenesis
    102985111 (PLA2G4A)
   04921 Oxytocin signaling pathway
    102985111 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102985111 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    102985111 (PLA2G4A)
   04726 Serotonergic synapse
    102985111 (PLA2G4A)
   04730 Long-term depression
    102985111 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102985111 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102985111 (PLA2G4A)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102985111 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 102985111
NCBI-ProteinID: XP_023989533
UniProt: A0A2Y9TH52
Position
4
AA seq 781 aa AA seqDB search
MSFIDPYQHIIVEHHYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISSTPDSRKRT
KHFNNDINPVWNETFEFILDPNQDNVLEITLMDANYIMDETLGTAIFPISSMKVGEKKEV
PFIFNQVTEMILEMSLEVCSSPDLRFSMALCDQEKAFRQQRKENIKENMKKLLGPKNSEG
LYSTRDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYIAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKSVSHNPLLLLTPQKIKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTGQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSKGSTMEEE
LENITAKHIVSNDSSDSDDESQEPKGTENEEAEREYQNDNQASWVQRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPMSPLRDFTTQESLEEDELDAAVADPDEFEQIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKAPGVPRETK
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVLNPACPVRLDVKW
ENPTVHTSPRPRGPHQLWVMKNAIVESVEYRRQNPSRCSVSLSSVEARRFFNREFLSKPT
A
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttatagatccttatcagcacattatagtggagcaccattattcccacaagttc
acagtagtggtgttacgtgccacaaaagtgacaaagggggccttcggtgacatgcttgac
actccagacccctatgtggaacttttcatctcctcaacccctgacagcaggaagagaaca
aaacacttcaataatgacataaaccctgtgtggaatgagacctttgaatttattttggat
cctaatcaggacaatgttttggagatcacgttgatggatgccaattacatcatggatgaa
acgctcgggacagcaatatttccaatatcttctatgaaagtgggagagaagaaagaggtt
ccttttattttcaaccaagtcactgaaatgattctggaaatgtctcttgaagtttgttca
tccccagacctccgatttagtatggctctgtgtgaccaggagaaagctttccgacaacag
agaaaagaaaacataaaggaaaacatgaagaaactcctgggtccaaagaacagtgaaggc
ttgtattctacacgtgacgtgcctgtggtggccatactgggctcaggtggggggttccga
gccatggtaggattctccggtgtgatgaaggcactgtatgaatcaggaattttagattgc
gctacctacattgctggtctttctggatctacgtggtacatgtcaactttatattctcac
cctgattttccagagaaagggccagaggagattaacgaagagctaatgaaaagtgttagc
cacaaccctcttttacttctcacaccacagaaaattaaaagatacgttgagtctttatgg
aagaagaaaagctctggacaacctgtcacctttactgatatctttgggatgttaatagga
gaaacactaattcacaatagaatgaacactaccttgagtagtttgaaggaaaaagtcaat
actggacagtgccctttgcctcttttcacctgtctccacgtcaaacccgatgtctcagag
ctgatgtttgcagattgggttgaatttagtccatatgagattggcatggctaaatatggt
acttttatggctcctgacttatttggaagtaaattttttatgggaacagttgtaaagaaa
tatgaagaaaaccccttgcatttcttaatgggtgtctgggggagtgccttttctatattg
ttcaacagagtcttgggagtttctggctcacaaagtaaaggttccacgatggaagaagaa
ctagaaaatattacagcaaagcatattgtgagtaatgatagctcggatagtgatgatgaa
tcacaagaacccaaaggcactgaaaatgaggaagcagaaagggaatatcaaaatgataat
caagcaagttgggtccaacgtatgataatggctttggtgagtgactcagctttgtttaat
accagagaaggacgagctgggaaggtgcacaacttcatgctgggcttgaatctcaataca
tcctatccgatgtctcctttgagagactttaccacccaggagtccctggaggaagatgaa
ttggatgcagctgtagcagatcctgatgaatttgaacagatatatgagcctctggatgtc
aaaagtaaaaagattcatgtggtggacagtggcctcacatttaacctgccataccccttg
atcctgagacctcaaagaggagttgatctcatcatctcctttgacttttctgcaaggcca
agtgactccagtcctccgttcaaggaacttctacttgcagaaaagtgggctaaaatgaat
aagctcccctttccaaagatcgatccttatgtgtttgatcgagaaggactgaaggaatgc
tatgtctttaaacccaagaatcctgatgttgagaaagattgcccaactatcatccacttt
gttctggccaacatcaacttcagaaagtacaaggctccaggtgttccaagagaaactaag
gaagagaaagaaatagctgattttgatatttttgatgaccctgaatcaccattttcaacc
ttcaactttcaatacccaaatcaagcattcaaaaggctgcatgatctgatgtatttcaat
accctgaacaacatcgatgtactgaacccagcttgcccagttagattggatgtgaaatgg
gaaaaccctactgtgcacacatctccaaggccaagagggccgcaccagctctgggtaatg
aagaatgccatagttgaaagcgttgaatatagaagacagaatccatctcgttgctctgtt
tccctcagtagtgttgaggcaagaagattcttcaacagggagtttctaagcaaacccaca
gcatag

DBGET integrated database retrieval system