KEGG   Physeter catodon (sperm whale): 102985206Help
Entry
102985206         CDS       T06011                                 

Gene name
GPX2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00480  Glutathione metabolism
pcad00590  Arachidonic acid metabolism
pcad01100  Metabolic pathways
pcad04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102985206 (GPX2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102985206 (GPX2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102985206 (GPX2)
Enzymes [BR:pcad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102985206 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102985206
NCBI-ProteinID: XP_007122141
UniProt: A0A2Y9FG39
Position
11
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAISLDGDKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLIQKCDVNGQNEHPVFTYLK
DKLPYPYDDPFSLITDPKFIIWSPVHRSDVSWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacatcgccaagtccttctacgacctcagtgctatcagcctggatggggacaag
gtagatttcaatacattccgaggcagggcagtgctgattgagaacgtggcctcgctctga
ggcacaaccacccgggacttcacccaactcaacgagctgcaatgccgctttcccaggcgc
ctggtggttcttggcttcccttgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaatagcctcaagtacgtccgccctgggggtggattccagcccacctttacc
cttatccaaaagtgtgatgtgaatggtcagaatgagcatcctgtcttcacctacctgaag
gataagctcccctacccttacgacgacccgttttccctcataaccgatcccaagttcatc
atttggagccctgtgcaccgctcagacgtgtcttggaactttgagaagttcctcatcggg
ccagagggggagcccttccgacgctacagccgcaccttcccgaccatcaacatcgagccc
gacatcaagcgcctcctcaaagttgccatataa

DBGET integrated database retrieval system