KEGG   Physeter catodon (sperm whale): 102987970Help
Entry
102987970         CDS       T06011                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00480  Glutathione metabolism
pcad00590  Arachidonic acid metabolism
pcad01100  Metabolic pathways
pcad04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102987970 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102987970 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102987970 (GPX7)
Enzymes [BR:pcad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102987970 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 102987970
NCBI-ProteinID: XP_007109580
UniProt: A0A2Y9EV28
Position
4
AA seq 247 aa AA seqDB search
MGRLRSRARRSRARRSTARVEEGGASCPAGRLEPGPPPPAPRARDPSPAFALATPPARER
VMVAGLAAAWLLLAAAACAQREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFT
DQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPNSNKEIESFARHTYSVSFPMFSKITV
TGTGAHPAFKYLIQTSGKEPTWNFWKYLVAPDGKVIGAWDPTVSVEEIRPQIAALVRKLI
LKKREDL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggggagactgaggtccagagcccggcggtccagagcccggcggtccaccgcccgcgta
gaagaagggggcgcgtcctgcccggctggccgcttggagccggggccgcctccgcccgcc
ccccgcgcccgtgaccccagccctgcctttgcccttgccacgccgcctgctcgggagcga
gtcatggtggcgggactggcggcagcatggctgctcctggcggctgctgcctgcgcgcaa
cgggagcaggacttctacgacttcaaggcggtcaacatccggggcaagttggtgtctctg
gagaagtaccgcggctcggtgtccctggtggtgaacgtggctagcgagtgtggcttcaca
gaccagcactaccgggccctgcaacagctacagcgggacctggggcctcaccacttcaac
gtgcttgcctttccctgcaaccagtttggccagcaggagcccaacagcaacaaggagatc
gagagctttgcccgccacacctacagtgtctctttccccatgtttagcaagatcacagtc
accggcactggtgcccaccctgccttcaagtacctgatccagacttctggaaaggagccc
acctggaacttctggaagtacctagtggccccagatggaaaggtgataggggcttgggac
ccaaccgtgtcggtggaggagataaggccccagattgcagctcttgtgaggaagctcatc
ctgaagaagcgagaagacttataa

DBGET integrated database retrieval system