KEGG   Physeter catodon (sperm whale): 102991807
Entry
102991807         CDS       T06011                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04080  Neuroactive ligand-receptor interaction
pcad04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102991807 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102991807 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 102991807
NCBI-ProteinID: XP_023983906
UniProt: A0A2Y9SZ03
Position
21
AA seq 77 aa
MNLRLCVQALLLLWLSLSAVCGGPLLQTSDGKGMEEGTIRHLVQPRGPRSGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccctgagcgcggtg
tgtggagggcccctgctgcagacttctgacgggaaggggatggaggaaggcaccatccgc
cacctggtgcagcccagagggccgaggagcggcccagggccctggcagggaggtcggagg
aagttccgccgccagcggccgcgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system