KEGG   Physeter catodon (sperm whale): 102994635Help
Entry
102994635         CDS       T06011                                 

Gene name
GUCY1B1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1 isoform X1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00230  Purine metabolism
pcad01100  Metabolic pathways
pcad04022  cGMP-PKG signaling pathway
pcad04270  Vascular smooth muscle contraction
pcad04540  Gap junction
pcad04611  Platelet activation
pcad04713  Circadian entrainment
pcad04730  Long-term depression
pcad04921  Oxytocin signaling pathway
pcad04924  Renin secretion
pcad04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102994635 (GUCY1B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    102994635 (GUCY1B1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102994635 (GUCY1B1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102994635 (GUCY1B1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102994635 (GUCY1B1)
   04924 Renin secretion
    102994635 (GUCY1B1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102994635 (GUCY1B1)
  09154 Digestive system
   04970 Salivary secretion
    102994635 (GUCY1B1)
  09156 Nervous system
   04730 Long-term depression
    102994635 (GUCY1B1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102994635 (GUCY1B1)
Enzymes [BR:pcad01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     102994635 (GUCY1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB 4_1_CTD
Motif
Other DBs
NCBI-GeneID: 102994635
NCBI-ProteinID: XP_007113386
UniProt: A0A2Y9F3E4
Position
7
AA seq 551 aa AA seqDB search
MFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKG
KGLILHYYSEREGLQDIVIGIIKTVAQQIHDTEIDMKVIQQRNEECDHTQFLIEEKESKE
EDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFSRDLVVTQCGNAIYRVLPQLQPGTC
SLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKSECEDELTGTEISCLRLKG
QMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQE
LEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIV
GFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEP
CIHHARSICHLALDMMEIAGQVQVDGESVQITIGVHTGEVVTGVIGQRMPRYCLFGNTVN
LTSRTETTGQKGKINVSEYTYRCLMTPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKI
TGTEETKQDAN
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagatgtttttcgtcttttgccaagaatctggttatgacacaatcctgcgt
gtgctgggatctaacgtcagagaatttctgcagaacctcgacgccctgcacgaccacctt
gctaccatctacccgggtatgcgggcgccttccttcaggtgcaccgacgcagagaagggc
aaagggctcatcctgcactactactcagagagagaaggcctgcaggacatcgtcatcggg
atcattaaaacggtggctcagcagatacacgacactgaaatagacatgaaggttattcag
caaagaaacgaagaatgtgatcatactcaatttttgattgaagaaaaagagtcaaaagaa
gaggatttttatgaagatcttgacagatttgaagaaaatggtacccaggaatcacgcatc
agcccatataccttctgcaaagcttttccctttcacatcatattcagccgggatctcgtg
gtcactcagtgtggcaatgccatctacagagtccttccccagctccagcctgggacttgc
agcctcctgtctgtcttctccctggtccgtcctcatattgacatcagtttccatgggatc
ctctcacacatcaatacggtcttcgtattgagaagcaaggaagggttgttggatgtagag
aagtcagagtgcgaggatgaactgacgggcactgagatcagctgcttacggctcaagggc
cagatgatctacttacctgaagcagacagcatacttttcctgtgctcaccaagtgtcatg
aacctggacgacctgacccggcgagggctgtacctgagcgacatccccctgcacgatgcc
acgcgggacctcgtgctgctgggggagcagttccgagaggagtacaagctgacccaggag
ctggaaatcctcacggacaggctgcagctcacactgcgcgccctggaagatgaaaagaag
aagacagacacgttgctgtactctgtccttcctccgtccgtggccaacgagctgaggcac
aagcgtccggtgcccgcgaagaggtacgacaacgtgactatcctcttcagcggcatcgtg
ggcttcaatgccttctgcagcaagcatgcatctggggaaggggccatgaagatcgttaac
ctcctcaacgacctctacaccagattcgacactctgacagattcccggaaaaatccattt
gtttataaggtggaaacggtcggtgataagtacatgacagtgagtgggttaccagagccc
tgcatccaccatgcacgttccatttgccacctggctttggacatgatggaaattgccggc
caggtccaggtagatggtgaatctgttcagataacaataggggtccacacgggggaggtg
gtcaccggcgtcatagggcagaggatgcctcgctattgtcttttcggaaacactgtcaac
ctcacaagccgaacagaaaccactggacaaaaaggaaaaataaatgtgtctgaatataca
tacagatgtctcatgacaccggaaaattcagacccacaattccatttggagcacagaggc
ccagtgtccatgaagggcaaaaaagagccaatgcaagtttggtttctatccagaaaaatt
acaggaacagaggaaacaaagcaggatgcgaactga

DBGET integrated database retrieval system