KEGG   Physeter catodon (sperm whale): 102996548Help
Entry
102996548         CDS       T06011                                 

Gene name
MRPL53
Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial
  KO
K17434  large subunit ribosomal protein L53
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pcad03011]
    102996548 (MRPL53)
Ribosome [BR:pcad03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    102996548 (MRPL53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 102996548
NCBI-ProteinID: XP_007107700
UniProt: A0A2Y9ES60
Position
12
AA seq 112 aa AA seqDB search
MAAALARLGLRSVKQVRVQFCPFEENVESTRTFLQAVSSEKVRCTNLNCSVITDVRHDGS
EPSVDVLFGDGHRLIMRGAHLTAQEMITAFASHIKARGAAGSGDKPGASTGR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggctttggctcggctcggactccgctcagtcaagcaggttcgggttcaattc
tgccctttcgaggagaacgtggagtcgacaaggaccttcctccaggccgtgagcagcgag
aaggttcgctgcaccaacctcaactgctcggtgataactgacgtgagacacgacggctcc
gaaccctccgtggacgtgctgttcggagacgggcatcgcctgattatgcgcggcgcgcac
ctcaccgcccaggaaatgatcactgccttcgcctcccacatcaaggccaggggtgcggcg
gggagcggggacaagccgggcgccagtaccgggcgctga

DBGET integrated database retrieval system