KEGG   Physeter catodon (sperm whale): 102996702
Entry
102996702         CDS       T06011                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102996702 (AKAP5)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102996702 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102996702
NCBI-ProteinID: XP_007102342
UniProt: A0A2Y9EIC6
Position
11
AA seq 428 aa
MEITVPEIQVESKNEKRSAEVSPQNERQEEKASTLCFKRRKKAAKAMKPKVGSEAADAAR
KCPPEAGASYQPEPPRGAWASIKRLVTRSKRSDSSKQQKPFEAKVQPEINAEDDNSKKKA
KSRLKIPCIIFSKGEKRSNHSKIIEDSDCSIKVQREAGSLDTKTLTQSDDQAAKTKLKQD
VREDVSQKGSDEVCQSNVNNSVTSPGEKVISVELELDTGHSAIQTGTLILEKDIETLEEK
QSIQPQQASPLETSDTEHQLPVVSDVPPSPAVPDQQILEEARNSILESGPDWKDRESKET
VAEESKPKDTELSQESDFQVNEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KQFLISIENEQVGVFANGSGFESRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NAKSNLLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagatcacagttcctgaaatacaagtagaaagcaagaatgagaagagatcagcagaa
gttagtcctcagaatgagaggcaggaggaaaaagcatcgacgctttgcttcaagagaaga
aagaaagcagccaaagcaatgaagcccaaagttggctctgaagctgctgatgcagcaagg
aagtgtcccccagaagcaggagcttcttatcagccagagcccccccggggggcctgggcc
tccatcaaacgccttgtaacgcgcagcaaaaggtcagactcttcaaagcagcaaaagccc
tttgaggccaaagtgcaacctgaaatcaatgctgaggatgataattctaaaaaaaaggca
aaatccagactcaagattccctgtataatattctcaaaaggggagaaaagaagtaatcat
tccaaaattatagaagactcagactgcagtatcaaagtccaacgagaggctggaagtttg
gatacaaaaactctgacccaatcagatgaccaggcagcaaagaccaagttgaagcaggat
gtaagggaagatgtctcacagaaagggagtgatgaggtctgtcaatcaaatgtgaacaac
agcgtaacctctcctggagagaaagtgatttcagtagaacttgagttagatacagggcat
tctgctattcaaacaggaactctaatccttgaaaaagatattgaaacgcttgaggaaaaa
caaagcattcaacctcagcaagcaagcccactggaaacttcagacacagaacaccagctc
ccagtggtttctgatgttcctccctcacctgcagtcccagatcaacaaattctggaagaa
gccagaaacagtatcctagaaagtggaccagattggaaagaccgtgaaagtaaagagact
gttgctgaggagagtaagccgaaagatactgaactgagccaggaatcagattttcaagta
aatgaaatcactgcagaaaaacccaaaccggaagaaagcaaaagaatggagccaattgct
attattatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagcaattcttaatttcaatcgaaaatgagcaagtgggggtttttgctaatggtagtggt
tttgagagtagaacttcagaacaatatgaaacactcttaatagaaacagcttcttctctt
gtcaagaatgctatccagttgtctatagaacagctggttaatgaaatggcctctgatgat
aatgcaaaaagcaatcttctacagtga

DBGET integrated database retrieval system