KEGG   Physeter catodon (sperm whale): 114485128Help
Entry
114485128         CDS       T06011                                 

Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04020  Calcium signaling pathway
pcad04713  Circadian entrainment
pcad04925  Aldosterone synthesis and secretion
pcad04927  Cortisol synthesis and secretion
pcad04929  GnRH secretion
pcad04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114485128
   04020 Calcium signaling pathway
    114485128
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    114485128
   04925 Aldosterone synthesis and secretion
    114485128
   04927 Cortisol synthesis and secretion
    114485128
  09159 Environmental adaptation
   04713 Circadian entrainment
    114485128
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    114485128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcad04040]
    114485128
Ion channels [BR:pcad04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   114485128
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 114485128
NCBI-ProteinID: XP_028341676
UniProt: A0A455BCG2
Position
Unknown
AA seq 400 aa AA seqDB search
GPPGLQTPLHVRVACTGPRVQLAETEAFSLNSDRSSSILLGDDLSLEDPAACPPGPRDSK
GEPDPPEPMRVGDLGECFFPLSNTAVSSGPENFLCEMESIPFNPVRSWLKHESSQAPPSP
FSPDASSPLLPMPAEFFHPAVAASQKGQEKGAGAGTLPKIALQGSWASLRLPGVNCTLRQ
QATGSNTSLEGSRSSSAGSLQTTLEDSLTLSDSPRRALGPPAPAPGLRAGPPPAARRRPS
LRGRGSFSLSGLRAHQRSHSSGGSTSPGCTQHDSMDPSDEEGAGGRAGGGGGGGGGAGSE
HSETLSSLSLTSLFGPPPPPPGLPSARRFGSTSSLAAGPGRPRAAARPRGLARSPSWAAD
RRKDPPCQADPAAARGPWTPEPQPPPGEPQPGDAASRGRR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ggtcctccgggcttgcaaacacctctgcacgtgcgggtagcctgcacagggccacgggtg
cagctggccgagacagaggccttctccctgaactcagacaggtcctcgtctatcctgctt
ggcgatgacctgagtctggaggaccccgcggcctgcccacccggccccagagacagcaag
ggtgagccggacccgcctgagccgatgcgggtaggggacctgggtgaatgcttcttccct
ttatccaacacggccgtctcgtcgggtccggagaactttctgtgtgagatggagtcgatc
ccattcaaccccgtacggtcctggctgaaacacgagagcagccaagcgcccccgagcccc
ttctccccggatgcctccagcccactcctgcctatgccggccgagtttttccaccctgct
gtggccgccagccagaaaggacaggagaagggcgctggtgccgggacactccccaagatt
gccctgcagggctcctgggcgtccctgcggttgcccggcgtcaactgcaccctccgtcag
caggccacggggagcaacacgtcgctggagggcagccgcagcagctcggcgggcagcctg
cagaccacgctggaggacagcctgaccctgagcgacagcccgcggcgcgccctggggcct
cccgcgcccgccccggggctccgcgccggcccgccgccagccgcccgccgtcgcccgagc
ctgcggggccggggctcgttcagcctgagcgggctgcgggcgcatcagcgcagccacagc
agcgggggctccaccagcccgggctgcacccagcacgactccatggacccgtcggacgag
gagggcgcgggcggccgggccggcgggggcggcgggggcggcgggggcgcgggcagcgag
cactcggagacgctcagcagcctttcgctcacctccctcttcgggccgccgcccccgccg
cccggcctcccgtccgcgcgcaggttcggcagcaccagcagcctggccgccggccccggc
cgcccccgcgccgccgcccggccccgaggcctggcccgcagcccctcctgggccgccgat
cgccgcaaggacccgccgtgccaggccgatccggccgccgcccggggcccctggacgccc
gagccgcagccgccgccgggcgagccacagcccggggacgccgcgagccgggggaggaga
tga

DBGET integrated database retrieval system