KEGG   Physeter catodon (sperm whale): 114487738Help
Entry
114487738         CDS       T06011                                 

Gene name
DHX8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    114487738 (DHX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pcad03041]
    114487738 (DHX8)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     114487738 (DHX8)
Spliceosome [BR:pcad03041]
 Complex C
  Other components
   Step II factors
    114487738 (DHX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2
Motif
Other DBs
NCBI-GeneID: 114487738
NCBI-ProteinID: XP_028355362
UniProt: A0A455C651
Position
14
AA seq 309 aa AA seqDB search
MLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEG
LLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQK
KAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKL
DVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVY
HELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEPLYNRYEEPNAW
RISRAFRRR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccaccaacgtgccggaaatccagagaaccaacttagcaagcacagtgctctca
ctcaaggccatgggcatcaatgacctgctgtcctttgactttatggatgccccgccaatg
gaaaccttgatcacagccatggagcagctatacacgttgggggccctggacgacgagggc
ctacttactcgcctgggccgcaggatggcagagttccctctggagccaatgctgtgcaaa
atgctgatcatgtctgtgcatctaggctgcagtgaggaaatgctgaccatcgtgtccatg
ctgtctgtgcagaacgtcttctacaggcccaaggataaacaagcccttgcagatcagaag
aaggccaaattccaccagaccgaaggggaccacctcaccctgctggccgtgtacaactcc
tggaagaacaataagttctccaacccgtggtgctatgagaacttcatccaggctcgttct
ctgcgccgggcccaggacattcgcaagcagatgttgggcataatggacagacacaagctg
gatgtggtctcctgtggtaagtccacagtccgagtgcagaaggccatctgcagtggattc
ttccggaacgctgccaagaaagacccacaggagggttaccggacactgattgaccagcag
gtggtctacatccatccttccagtgctctcttcaacagacagcccgaatgggtggtgtac
catgagctggtgctgaccacgaaggagtacatgcgtgaggtcaccaccattgacccccgg
tggcttgtggagtttgctccagccttcttcaaggtctctgacccgaccaagctaagcaag
cagaagaagcagcaacgactggaacccttatacaaccgctatgaggaacccaacgcctgg
agaatatcccgagccttccggcggcgctga

DBGET integrated database retrieval system