KEGG   Pomacea canaliculata (golden apple snail): 112553452Help
Entry
112553452         CDS       T05881                                 

Definition
(RefSeq) glutathione peroxidase 1-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00480  Glutathione metabolism
pcan00590  Arachidonic acid metabolism
pcan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    112553452
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112553452
Enzymes [BR:pcan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     112553452
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 112553452
NCBI-ProteinID: XP_025076456
AA seq 241 aa AA seqDB search
MNNKSRNLSLTKASQQINAVTCLFGGRPVPASSVSSFYQLSAPLINGRMEPLSRHEGRVC
LVVNMASADPTTRQELMQLNDLVTVFGPHGLSVLVFPCNQFGGLEPFYNDEIPLILQNVR
PGAKFETKFQLFAKCEVNGSSASPVYEYLKVKLPLPTNDDSVLSHDSQHPATWKPVTRYD
VSWNYEKFVVCYDGQPSKRFTNKVSYELIRKEVESCLRKIPKSVREHHGFTPFETLLHTY
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaaagccgaaatttatcattgaccaaagccagccagcaaatcaacgctgtc
acgtgcctctttggagggaggcctgttccggcttcttcagtttcgtcattctaccaactg
tcggcacccctcatcaacgggcgcatggagccactctctaggcacgaaggtcgggtgtgc
ctcgtagtgaacatggcttccgctgaccctaccactaggcaagagctcatgcagctcaat
gatttggtgactgtattcggcccacatggtctgagtgtgctggtgttcccctgcaaccag
ttcggaggcttggagccgttctacaacgacgagattcctttgatcctccagaatgtgcgg
ccaggagccaagttcgagacaaagtttcaactcttcgccaagtgtgaggtaaacggaagc
agcgccagtcctgtatacgaatacctcaaagtcaagctgcctcttccaaccaacgacgac
tctgtgctgtcacatgacagtcaacatccagcaacatggaagccagtcacgcgctatgac
gtaagttggaactatgaaaaatttgtggtctgctacgacggccaaccctcgaagaggttc
accaacaaggtgtcctatgaactaattcgtaaagaagtagagagctgcctcaggaaaatt
cccaaatctgttcgagagcatcatgggttcacaccttttgagacactgttacatacctac
aggtag

DBGET integrated database retrieval system