KEGG   Pomacea canaliculata (golden apple snail): 112554767Help
Entry
112554767         CDS       T05881                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00520  Amino sugar and nucleotide sugar metabolism
pcan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    112554767
Enzymes [BR:pcan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     112554767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short Cupin_8
Motif
Other DBs
NCBI-GeneID: 112554767
NCBI-ProteinID: XP_025078563
AA seq 406 aa AA seqDB search
MFRAFNYIPYRKMRVVFLLVGFAAIAAVIYASIPSAVTYQKRGLSGNNLHDELVFLEMKI
RDLEQGKKKYPDVKFLTYKDRKRILVTGGAGFVGSHLVDRLMMEGHEVTVVDNFFTGRKR
NVEHWIGHENFELLHHDIVNPLYIEVDEIYHLACPASPPNYMYNPIKTIKTSTLGTINML
GLAKRVRARVLLASTSEVYGDPEQHPQTEDYWGHVNPIGPRACYDEGKRVAETMCYAYNK
QENVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQNESITVYGDGTQTRSFQYVSDLVD
GLMRLMASNYSLPINLGNPEEHTIMDFAQIIKNLVGGESRIVTKKPMQDDPQRRRPDITR
ANKYLNWEPKVPMMVGINKTIEYFRNELRRSRHSERNFHAPDYFQV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgcgcatttaactacattccatatcgaaaaatgagggttgttttccttttagtt
ggatttgccgcaatcgcagcggtgatatatgccagtataccttcagctgtaacataccaa
aaaagaggactatcaggaaacaaccttcacgatgaactggttttcttagagatgaaaatt
agagatctagagcaaggaaagaaaaagtatcctgatgtgaaattcttaacctacaaagat
cgaaagaggattttggtaacaggtggagcaggctttgttgggtctcatcttgtagatcgt
ttaatgatggaaggtcatgaggtgacagtagttgataatttcttcactggccgtaagcgg
aatgttgaacactggattgggcatgaaaattttgagcttttacaccatgacattgtcaac
ccattgtacattgaagttgacgaaatttatcatctggcctgtccagcgtctcctccgaac
tacatgtacaatccaatcaagaccatcaagactagcacacttgggaccatcaatatgctt
ggccttgccaaaagggtgcgagccagagttcttctagcctctacatcagaagtttatgga
gacccagaacaacatccacagacagaagattactggggtcacgtcaaccccataggacca
agagcctgttatgatgaaggaaagcgagtggctgagactatgtgctatgcatacaataaa
caggaaaatgttgaagtacgtgtagcaagaatattcaacacatttggacctcgcatgcat
atgaatgatggtcgtgtagtcagcaacttcatccttcaagctcttcagaatgagtctatc
actgtgtacggagatggaacacagacacgctcattccagtatgtgagtgaccttgtggat
ggcctgatgcgattgatggcctctaactattcccttcctattaatcttggcaatccagag
gagcacacaattatggactttgcccaaattatcaaaaatcttgttggaggagagagtcgc
attgtcaccaaaaaacccatgcaggatgacccacagagacgaagaccagatataacacga
gctaacaaatatctcaactgggaacccaaggtaccaatgatggtgggtatcaataaaacg
attgaatacttccgcaatgagttacgaagatcgcgacacagtgagcggaatttccatgca
ccagactactttcaggtttga

DBGET integrated database retrieval system