KEGG   Pomacea canaliculata (golden apple snail): 112555422Help
Entry
112555422         CDS       T05881                                 

Definition
(RefSeq) galactocerebrosidase-like
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00600  Sphingolipid metabolism
pcan01100  Metabolic pathways
pcan04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    112555422
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    112555422
Enzymes [BR:pcan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     112555422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30 VIT
Motif
Other DBs
NCBI-GeneID: 112555422
NCBI-ProteinID: XP_025079601
AA seq 678 aa AA seqDB search
MADNTKAINLFLLDDAAGVGRTFDGIGGLSGGSATSKLLADYKEPQRTEILDYLFKPNFA
ASLQILKVEIGGDAIASDATEASHMHNSWEENYQRGYEWWLMKEAKKRNPNIKLYGLPWD
FPGWIGNGTQNPYQDVVRLATYITKWIQGAKVYHNLDIDYIGIWNERSYDIAYIKTLRLM
LDQLGFENTRIVASDDGFQYIVEDMYKDAELTAAIDIIGVHYPGTYSPQNAIQLGKTLWS
SEDYSTIDNTIGGGCWARILNQNYVNGYMTSTIAWNLIDSYLEGLSWDRDSLMTAREPWS
GFYIVESPIWVTAHTTQFSSPGWSYLRHGHGVDHLEKGGSIVSLTSPDKTDLTVVIETMS
HDQSVCIRPNLPGYEVEPQNISLILMGDYVDIKELQVWYTKLGGNTSSSVYFSYRGTVPV
QNGLVTLSLGVNEIYTLTTLTTGKRGQYPDPPASKPFPIDYYNFFYELNDSSEAPYFSAQ
QGVFEIVSVSDYEKHMRQMVLEPPIVWCGVSGKINATMSVLGSDKWTDIYVKAETFMVAI
NGSKAVYIAARIDSSKTGCDTISATGLFFFVIPLDQRYFLAKDLAGSSVITGGQSPAIDG
VHNVLELLVLNGFVFGMVNNVDLFNVSIPHDASPSGFVGVGTDSFGYADFGYFITRNASN
ALIRKEDKTLRFQSMVHD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggctgataacacgaaagctataaatctttttttgctggatgacgctgctggtgtaggt
cgtacatttgatggaattggtggcctaagtggaggttcggcaacctcaaagctactggca
gattataaggaacctcagagaacagaaatattagattatttgtttaagcccaactttgca
gcatctctgcagattctaaaagtagagattggaggagatgccattgcatcagatgctaca
gaggcatcacatatgcacaacagctgggaagaaaactaccaacgtggttatgagtggtgg
ctgatgaaagaagccaaaaagagaaatccaaacataaagctgtatggacttccatgggac
tttcctggctggattggaaatggaactcagaatccttaccaggacgttgttcgtttggcc
acgtacatcacaaagtggattcagggtgcaaaagtgtatcataatctggacattgactat
attgggatctggaatgagagatcatatgatatagcatatataaagacactgagactgatg
ttggatcagcttggatttgaaaacactcgcatagttgcatcagatgatggctttcaatac
attgtggaggacatgtataaggatgcagagctgactgctgcaattgatattattggtgtc
cattatcctggaacttacagcccccagaatgctattcagctggggaaaacgctatggtca
tcagaggattacagcacaattgacaacactattggaggaggatgctgggccagaatttta
aaccagaactatgttaatggatacatgacaagcacaattgcttggaacctaattgacagc
tacttggaaggcttgtcttgggacagggactctttgatgactgctagggaaccttggagc
ggcttctacattgtggaaagtcccatctgggtcacagcccacaccactcagtttagttcg
ccaggctggagttacttacgccatggccatggcgtggatcatcttgaaaaaggtggtagc
attgtctctcttacaagtccagacaagactgatctcacagttgtcatagagaccatgagt
catgaccagtctgtgtgcattagacctaatctgccaggatatgaagttgagccacagaat
atcagcctaattcttatgggtgattatgttgatataaaagagctacaagtgtggtacact
aaactaggtggaaatacttcctcatctgtgtacttttcttaccgtggcacagtgccggtc
cagaatggtttggtgacgctgtctctgggagtgaatgaaatctacactctcaccacacta
accacaggcaagaggggacagtaccctgaccctccagcttctaagcctttccccattgat
tattataacttcttttatgaactgaatgatagctcagaggcaccatacttctcagcacag
caaggagtgtttgaaatagtgagcgtttcagattatgagaagcatatgcggcagatggta
ttggagccaccaatagtgtggtgtggtgtaagtggcaagatcaatgccacaatgagtgtg
ctgggtagcgacaagtggacagatatctacgtcaaagcagaaacatttatggtggctata
aatggaagcaaggcagtctacattgcagctcgcatcgacagctcaaagacaggttgtgac
acaatcagtgccacgggactctttttctttgtcattcctctggaccagcgctattttctg
gccaaagatctcgctggcagttccgttattacgggtggacaaagtccggccattgatggt
gtacacaatgttttggaactactggtacttaatggctttgttttcggaatggtgaacaat
gtggatttgttcaatgtgtccataccccatgatgcatcaccaagtggttttgtgggcgtc
ggcacagattcctttggttatgcagattttggatatttcattacacgcaatgcttcaaat
gcattaattaggaaagaagacaaaactctaagatttcaaagcatggtacatgattga

DBGET integrated database retrieval system