KEGG   Pomacea canaliculata (golden apple snail): 112556079Help
Entry
112556079         CDS       T05881                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating-like
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00030  Pentose phosphate pathway
pcan00480  Glutathione metabolism
pcan01100  Metabolic pathways
pcan01200  Carbon metabolism
Module
pcan_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pcan_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    112556079
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112556079
Enzymes [BR:pcan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     112556079
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     112556079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored Shikimate_DH NAD_binding_11 HHH_9 Ub-Mut7C ApbA
Motif
Other DBs
NCBI-GeneID: 112556079
NCBI-ProteinID: XP_025080479
AA seq 483 aa AA seqDB search
MSSPQGDIALIGLAVMGQNLILNMNDHGFTVVAFNRTVSKVEEFLKNEAKDTKVIGATSL
QDMVQKLKKPRRVMLLVKAGQAVDDFINSLVPLLEKGDIIIDGGNSEYRDSIRRCKSLKE
KGLLFVGSGVSGGEDGARYGPSLMPGGSDEAWPAIKEIFQSIAAKAGNDPCCDWVGPEGA
GHFVKMVHNGIEYGDMQLICEAYSLMKDALGMTHGEMAEIFNSWNKSELESFLIEITRDI
MKFNDADGQPLVEKIIDSAGQKGTGKWTAIASLEYGVPVTLIGEAVFARCLSSLKEERVA
ASQVFPAPTSRFSGDKKAFVEDIKNALYASKIVSYAQGFMLMRETAKELGWKLNYGSIAL
MWRGGCIIRSVFLGNIKQAFDKNPSLSNLLVDSFFKEEIAKCQASWRRVVSTAVTLGIPT
PAFSTALAFFDGYRSARLPANLIQAQRDYFGAHTYERVDSPGKFVHTNWTGHGGSVSSTT
YQA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcccctcaaggtgatattgccctaattggtcttgctgtgatgggacagaacttg
atcctcaacatgaatgatcatggctttactgtggtggccttcaacagaacagtttccaaa
gtggaagaatttttgaaaaatgaagccaaagataccaaagtgattggtgccacttcacta
caggacatggtccaaaagttgaaaaagcccagacgtgttatgctacttgtcaaggctggg
caagcagtggatgacttcatcaacagcctggtcccactgctggaaaagggtgatatcatt
attgatggtggaaactcagagtacagagactctattaggcgctgcaaaagcctgaaggag
aaggggctgctctttgtggggagtggagtatctggaggagaggatggcgcccgctatgga
ccttcacttatgcctggtggttctgatgaagcatggcctgcaattaaagaaatctttcag
tcgattgctgctaaagcaggaaatgacccatgctgtgactgggttggcccagaaggagca
ggtcactttgtgaagatggttcacaatggcattgagtatggagacatgcaacttatctgt
gaagcctacagcctcatgaaggatgccttaggcatgacacatggagaaatggcagagatt
tttaacagttggaacaagagtgagctggaatccttcctcatcgaaatcactcgtgacata
atgaagtttaatgacgccgatggacaacctctagtagagaaaatcattgacagtgctgga
cagaagggaactggaaaatggacagcaattgcttccttagagtatggagtgcctgtaact
ctgattggtgaggctgtctttgcacgctgtctctcatccctgaaagaagagcgtgtggct
gccagccaggtctttcctgcacccacctctcgtttttctggagacaagaaagcattcgtt
gaggacattaaaaatgctttgtatgcctccaaaattgtgtcgtatgctcaaggtttcatg
ctcatgagagagacagcaaaagagcttggatggaagcttaattatggttccatcgcattg
atgtggcgaggtggttgcatcatccgtagtgtgttcctggggaatatcaaacaggcattt
gacaaaaatcccagtctcagcaatcttctggtggatagtttcttcaaggaagaaattgca
aagtgtcaggcgtcatggcgacgtgtagtttccacagcagttaccttgggaattcctacg
cctgcctttagtactgctttggccttttttgatggttaccgtagtgcccgtcttcctgcc
aaccttatccaggctcagcgagactattttggagctcacacttatgagcgcgttgattct
cctggaaagtttgtccacaccaactggacaggtcacggaggttctgtctcatcgactaca
taccaagcctga

DBGET integrated database retrieval system