KEGG   Pomacea canaliculata (golden apple snail): 112556466Help
Entry
112556466         CDS       T05881                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00260  Glycine, serine and threonine metabolism
pcan01100  Metabolic pathways
pcan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    112556466
Enzymes [BR:pcan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     112556466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 112556466
NCBI-ProteinID: XP_025081289
AA seq 444 aa AA seqDB search
MMCSVCTVNYLLMLKKVILTGIIPGSPVFVHMPIIWRFFTHARFVMSTTVTRYFLSGKLK
LCHHQIVLYGTSAASSKNDIYVVNLRSDTFTLPTSSMKKAMVEAHLGDDVYGEDPTVNRL
QKECATLLGKDAALLIPTGTMGNTAAMLSHCHGLFEEILLGDQSHMHFGEVGAIATLAGI
HSRTVTNKCDGTMDINELREKIRIKKDPHYPQTRVICLENTHNRCGGTILPLNFLEQVRD
VADAHHLAMHLDGARLMHAAVAQEVAPCEIAQYFDSVSMCFSKGLACPVGSILAGSKDFI
ERALWARKALGGGMRQAGVIAAPMLVALNEIVPHLREDHARARKIAQAIVDVKENNFLKL
NMELVQTNIGMLHMDCNISTRKLCERLTQVTDEEFEVLGERISVQMMPFSDTLIRFVTYY
GITDKDVDKAIKKLQYVLTGMSTC
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgtagtgtgtgcactgtaaactacctgcttatgctcaagaaggtgattttgaca
ggcatcataccagggtctccagtctttgtgcatatgcctattatttggaggttcttcact
catgcaagatttgtaatgagcactactgtaactagatactttctctctggcaaacttaag
ttgtgccaccatcagatagtgctgtatggtaccagtgctgcatctagtaaaaatgacatc
tatgttgtcaacttgcgaagcgatactttcacgctgcctacatcttcaatgaagaaagcc
atggtggaggcacatcttggagatgatgtatatggggaggaccccactgttaacaggcta
caaaaagaatgtgcaacactgttggggaaagatgcagctctgctgattcccactggcacc
atgggcaacactgctgccatgttatctcattgtcatggactgtttgaagaaatattactg
ggagatcagtcacacatgcattttggtgaagttggagcaattgctactctggcaggaata
cattctcgaactgttaccaacaagtgtgatggcacaatggacattaatgagcttcgggaa
aagatacgcatcaagaaagacccacactatccccagacacgtgtcatttgcttggagaac
acccataatagatgtggtggtaccatccttccactgaactttttagagcaggttagggat
gtggctgatgcacatcatcttgcaatgcacttggatggagcacgactaatgcatgctgca
gttgctcaggaagtggcaccttgtgaaattgcacagtattttgactctgtttcaatgtgc
ttttcaaagggtcttgcctgccctgtaggaagcattttggctggttcaaaggattttata
gaaagagctttgtgggcacgaaaagccttgggaggtggaatgcgacaagctggagttatt
gctgcaccaatgttagtagcactgaacgagattgttccccacctcagggaggatcatgct
agggctagaaaaatagcccaagctatagttgacgttaaagagaataacttcctgaagcta
aatatggagttggttcagactaatataggcatgttgcatatggactgcaatatcagcaca
agaaaattgtgtgagcgattgactcaggtcactgatgaagaatttgaagttcttggagag
cgaatctctgtgcagatgatgccattttctgacactcttattcgctttgtgacttattat
ggtattacagacaaagatgttgacaaggccataaagaaactccaatatgttctgacaggt
atgtcaacatgctaa

DBGET integrated database retrieval system