KEGG   Pomacea canaliculata (golden apple snail): 112557420Help
Entry
112557420         CDS       T05881                                 

Definition
(RefSeq) glutathione S-transferase kappa 1-like
  KO
K13299  glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00480  Glutathione metabolism
pcan00980  Metabolism of xenobiotics by cytochrome P450
pcan00982  Drug metabolism - cytochrome P450
pcan01100  Metabolic pathways
pcan04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112557420
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112557420
   00982 Drug metabolism - cytochrome P450
    112557420
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    112557420
Enzymes [BR:pcan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112557420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSBA
Motif
Other DBs
NCBI-GeneID: 112557420
NCBI-ProteinID: XP_025083033
AA seq 225 aa AA seqDB search
MGSKKTLVEFFYDVVSPYSRFAFEVLCRYKGIWNMDLKLKPVFLGGIMQATGNQPPATNA
TKASYLVTDMKHLSQYFNLSYNQPKDFWNVIVTKGTLKTQRFITAVDMTRPEFTEQLSRE
LWNRIYVEDLDATEPESLRQAALKAGMNENLISDALNRMTQKDVKDRLIAYTKEALDLGA
FGAPYIVAHVNGKKEIFFGSDRFPVMALIIGEKWQGPDPGVKSHL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggctcgaaaaaaaccctcgtcgaatttttctacgatgtcgtttcaccttactcacgg
tttgcctttgaggtactgtgccggtacaaagggatttggaacatggatcttaagttgaaa
cctgtcttcctcggaggcattatgcaggctactggcaatcagcctcctgccactaatgcc
accaaggcttcatatttagtcacagatatgaaacacttgtcacagtatttcaatctttca
tacaaccaaccaaaggatttctggaatgtgattgtgaccaagggaacattgaaaacacaa
cgatttattacagcagtagacatgacaaggccagagtttacagagcagctgtctcgtgaa
ttgtggaaccgcatttatgttgaggatctggatgctactgaaccagagagccttagacag
gctgcattgaaagctggcatgaacgagaatttaatcagcgatgccttgaatcgtatgaca
caaaaagacgtcaaggacaggctgatagcttatactaaagaggctttagacctaggggct
tttggagccccatatatagttgcccatgtgaatggcaagaaagagatattttttggctct
gacaggtttcctgtgatggcattgatcataggggagaagtggcagggaccagaccctgga
gtaaaatctcatctgtga

DBGET integrated database retrieval system