KEGG   Pomacea canaliculata (golden apple snail): 112557841Help
Entry
112557841         CDS       T05881                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00010  Glycolysis / Gluconeogenesis
pcan00562  Inositol phosphate metabolism
pcan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112557841
   00562 Inositol phosphate metabolism
    112557841
Enzymes [BR:pcan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     112557841
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     112557841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Rrn6 His_Phos_1 DUF4924
Motif
Other DBs
NCBI-GeneID: 112557841
NCBI-ProteinID: XP_025083708
AA seq 470 aa AA seqDB search
MSAMWKRAVVVAVRNAFHTILLFGLFSPVLGYKYFSTKTPYAWGRSVHDKDLEDQWFNDN
SGELLCSAIHTSVVARHGTRYPGQDDVKKLTEIHRKILNDEVKTRYPDLYAWRNPFPDNN
NKALASLGEEELESYGKRTAQRLFSLFAEEDIDSFRYITSSTDRTRESSRAFFEGLTSVL
EENAQTEEDEYEPEVTDKLLRFHTQCDNYVKSVGNNKTAMKEYYKFLEGKYIATTKRKIS
EKLGITEDTLSPGDIRTLYLGCGYESAIFETSPWCQLLDEEDMIVQEYLGDLKHYYKNGA
GHDITWKQACPLVSDIFYTMDDAIESLETMDGADDEQGYIIGQFAFGHAETLGPLYTALG
LFNDSTPLRADNFKEHEDRLFRSSLILPFGANLQLILYECEPQDLKANEDDDAEHHPEYF
VKLLVNEEPQLLPGCDEFLCPYSIIRDKYKAQVENCNFSQICKWHPKDEL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccatgtggaaacgagcggtggttgttgctgtgcggaatgcgtttcacaccatt
ttattatttggcttattttcaccagttcttggatacaaatatttttcaacaaaaactccc
tatgcatggggtcgctcggtgcacgacaaagacctggaagatcagtggtttaacgacaat
tcaggagagttattgtgttctgctattcatacaagtgtggttgcaagacatggaacacgt
tatccagggcaagacgatgtgaagaaattgaccgaaattcacagaaaaatattgaatgat
gaagtgaagacacgttatcccgacctgtacgcatggaggaatccgtttcctgataataat
aacaaagctttagctagtcttggagaagaagaactcgaaagctacggaaagaggactgcc
caacgtctcttttctttgtttgctgaagaagatattgatagctttcggtacataacgtcg
agtactgacaggacgagagaaagttcgcgtgcgtttttcgaaggattaacgagtgtactc
gaagagaacgcacagacagaagaggatgaatatgaaccagaagttacagacaaattgttg
cggtttcacacacagtgtgacaactatgtcaagtcggtgggaaataataaaactgcaatg
aaggaatactataaattccttgaaggaaaatatattgcaacgacaaaaagaaaaatttca
gaaaagttaggtattacagaagatactctttctccaggggatattcgaactctctacctt
ggctgtggttacgaaagtgcaatatttgaaacctccccctggtgtcagctgcttgatgaa
gaagatatgattgttcaagaataccttggtgacttaaagcactactacaagaatggagct
gggcatgacatcacatggaagcaggcatgtccattagtttctgacattttctacaccatg
gacgatgctattgaatctttggagacgatggatggtgcagatgatgagcagggttacatc
attgggcagtttgcatttggtcatgctgaaacactgggtccattgtacactgcactgggt
ctctttaacgactccactcctctgcgtgctgacaatttcaaggaacatgaagatcgttta
ttccgctcgagcttgattttgccctttggtgctaatttacaactgattctctatgaatgt
gaacctcaggacctcaaggcaaacgaggatgatgatgctgagcaccaccctgagtacttt
gttaaacttctggtaaatgaggagccacagctactcccaggctgtgatgaatttctctgt
ccatacagcatcattcgtgacaagtacaaggctcaggtagaaaactgcaactttagtcaa
atatgcaagtggcatcccaaagatgaattatga

DBGET integrated database retrieval system