KEGG   Pomacea canaliculata (golden apple snail): 112560838Help
Entry
112560838         CDS       T05881                                 

Definition
(RefSeq) uncharacterized protein LOC112560838 isoform X1
Organism
pcan  Pomacea canaliculata (golden apple snail)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 112560838
NCBI-ProteinID: XP_025088700
AA seq 856 aa AA seqDB search
MEDNRNKATCVFCGHENSVKNDCGKLHITKTGHLAAHHKCMQYSSGLGQYKSHHFGGFKV
RQVEQEQIRGKSMHCRLKKCLANGKTGATAGCAWRYCRKSYHFLCAHSKGLTSRRLRKKK
PKQAVMYLVFCKPEHKKKYLEMEKKKGYKNETQSESDGEQDSTSNDDGDDDDDSSTDGST
TSDQKLFCKSSATRPRKLNRKHRVTHKSPSKSKVCPLEDENALSESAQRSQGKIDGKETS
PGLLTSLSNNSPKNIEFDCMRKLCKNNSDLQPSATDVLSVHSKYQQDMKDNVEEDLVSQS
LGTRTQCHVQKRKSSTQTGDKKRTKMKKRNSEHSSKIETSSSLNMQSFKKRCVKSPPQKT
KEGEQRKLPLVENGHESTRDDDKSDISVMTDEDSNDSTSNLSLKKLCETKETIENNNCRI
GCVTLLDSRSEAVAGSSTFPSLQSTSVNQNDVDHSNEEKEEIHTSQTSVPLPPLEFLLHS
DDSQSSLCSASQEKNSPLCDVLVENSCHGNQQETKNWKDSSSEDECLLVLPADESKFKAE
AASVCQDLANDWVIDITQTHIWSKVRPVPVQEKLMLSFICSIFEAVSCDSLNELRMLLLD
AKFIQDKCEELQDNKLVQVLNMQGNAHLKLSSVKAEIKRIKDLENKILAEKEGRLVDLCS
SHGVNYAVLKINKLTDPDHFIRDHLKTFCLHFLLNQNSPFVIANREIEPCDPQEEFSVLE
KWFTSCFQHVYKVLDYPKDEILYTLDAKSDELYATFKSIVYSREASKNDDDSLPVVIFVG
KLNSDIINFEQYLEALGEKILPTYRPRPVICIFPVSNFSSRLAPHSKVPVHCWSAYDPAF
KPVNYIVASWKKSWLL
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggaggacaacagaaataaagccacatgtgtgttttgtggtcacgaaaacagtgttaag
aatgattgtggaaagctacacataacaaaaacaggacatcttgctgcccatcacaaatgc
atgcaatattcttcaggtttgggtcagtataaatctcaccattttggtggatttaaagta
cgccaagtagagcaagaacaaatcaggggaaaaagtatgcactgtcgccttaaaaaatgt
ttggcaaacggcaaaaccggtgctacagctggatgcgcttggcgatattgtcgaaaatct
tatcatttcttgtgtgcccacagtaaaggacttacttctcgaagactaagaaaaaaaaaa
ccaaaacaagcagtcatgtatcttgttttttgtaaacctgaacacaagaaaaagtactta
gagatggaaaaaaagaaaggatataagaatgaaacacagagtgaaagtgatggagaacag
gacagtacaagtaatgatgatggtgatgatgatgatgatagcagcactgatggatccact
acttctgatcaaaaattattttgcaaatcatcagctacacgtcccagaaagctaaatagg
aaacacagagttacccacaagtctccaagcaaaagcaaagtgtgtccactggaggatgaa
aatgctctttcagaatctgcacagaggtcacaaggtaaaatagatgggaaggaaacatct
ccaggtcttttaacttcattatctaataatagccctaaaaacatagagtttgactgtatg
agaaaattatgcaaaaataactctgatctacagccatcagccactgacgttctttcagta
cattcgaaataccaacaagacatgaaagataatgtggaagaagacttggtgtcacagtct
ttaggcactcgcacacaatgtcatgtacagaaaaggaaatccagcacacaaacaggagat
aaaaaaaggacaaaaatgaagaaaagaaacagcgaacattcatccaaaattgaaaccagt
tcatccttaaacatgcaatcatttaaaaaacgatgtgttaaatcacctcctcagaaaact
aaggaaggagagcaaagaaaactacctttagtagagaatggtcatgaaagtacaagagat
gatgataaaagtgacataagtgttatgacagatgaggattctaatgatagcacaagtaat
ttatccctaaaaaaactatgtgagaccaaggaaacaattgaaaataacaattgtagaata
ggatgtgtaacactgcttgatagtagatctgaggcagtagctggatcttcaacctttcca
agtctgcagagcacaagtgttaatcaaaatgatgttgatcactccaatgaagaaaaggaa
gagatacacacctcgcagacatctgtacctcttcctcctctggaatttctgcttcacagt
gatgattcacaaagttcactttgttctgccagccaggagaaaaactcgcctttgtgcgat
gttttggtggaaaattcctgtcatggaaaccaacaggaaacaaagaactggaaggacagc
tcttctgaagatgaatgcctacttgttttgccagccgatgaaagtaaattcaaagcagaa
gcagctagtgtgtgtcaggatttagcaaatgactgggtcattgacatcacacaaacgcat
atttggtctaaagtgagaccagtaccagttcaagaaaaactgatgttgagtttcatttgt
agcatttttgaagcagttagttgtgacagcttgaatgaactgagaatgctgctccttgat
gcaaagttcatacaagacaagtgtgaggaactccaggacaacaaactggtccaggttttg
aacatgcagggaaatgctcatttgaaattgtcttccgtgaaagctgaaattaaacgcatc
aaggatcttgagaacaagattctagctgaaaaagaaggaagactggtggatttgtgcagc
tcacatggtgtgaactatgctgtcctgaagataaacaagttaactgatccagaccatttt
ataagggatcacctaaagacgttttgcctgcattttctgttaaaccaaaattcaccattt
gtgatagccaatcgggagatagagccatgtgatcctcaggaagaattttcggtcctggag
aaatggttcacctcttgttttcagcatgtttataaagttcttgactatccaaaagatgag
atattgtacacacttgatgctaaatctgatgaattgtatgctacatttaaatctatagtg
tacagccgtgaagcatctaaaaatgatgatgattccttgccagtggttatctttgttggc
aaactaaacagtgatatcatcaactttgaacagtatttggaagctctaggggagaaaata
cttcctacctacaggccacggccagtgatatgcatattcccagtgtctaattttagttca
aggcttgctcctcactctaaggtaccagttcattgttggagtgcctacgatcctgctttt
aaacctgtcaattatattgttgcttcgtggaagaagagctggttattataa

DBGET integrated database retrieval system