KEGG   Pomacea canaliculata (golden apple snail): 112563488Help
Entry
112563488         CDS       T05881                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 14-like
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112563488
Enzymes [BR:pcan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     112563488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP Macro RRM_1 RRM_occluded WWE
Motif
Other DBs
NCBI-GeneID: 112563488
NCBI-ProteinID: XP_025093182
AA seq 1491 aa AA seqDB search
MMESEQEDDFLFVFTEEASLDTSLISVMSAIRVDGVLPSMSMDYIQLHFESKKKSGGGDI
VQSHDFRSKGFVIFVYETSEVVKEVLKRPQVIDGHHLKVSRYEEHIPAQETDIVQEKLEK
PRTVSVRGVPTTFSTEIVTYYFENKRRSKGGPVEGVTKSLEEDVFFVKFDNPEDAARVAS
HEHILEGRKLQVCIYTPPQMIPDRLLVRGLPDVSVGEELKLYMEARSDTDVDSILYGDGG
VAVVIFAGNIDIQKLQEGFKKRQFKNVTLEVEPIPCMCTIQVYNLPEKPSPSEDMLRNYF
ESEHSSGGGEVTRVQIDEKRNYALITFKDATAASKALSRSHTIQGKKVELLPFYTCLGPT
GGRSSPPVKIPGKQSLSETARQKIVHLKGIHELWQEFDSLLQQHHACFIEACSTESVYIE
CSLTQDTAGVRQLAAAWTQDAKNAVEDYLSKITIEEVMVMSKVFSETGATIRDLAERAGA
FIKYDSTQGLLFLITKEASTDLVTDIKKTFAEAEEMLNRKSRERCEDFPLEVRTYDFFVK
NHVKMKEIQETHSKLKVCYDHQRKMLRLTGSEAEIEEVKKFCQRIAICQHMWDNEATREL
FRHPEAQKVIQTVCRESDPEGDVEFTEDGVVIYSLDKNKMGTMKETCLGHVRREKIVLSE
EFGEACKTDKWKKFKEKFQQLGKGTVLIKEEQTNLIVVGVGSKFNICYEEAKKFFQENVF
LKRTFFIEDEDLAPLYKYSIQDYVASNMKLTAKEVLLGKGCLSITGNMLEISAFERAMES
LNTKKTLKEKTFNEPSLFRFLKSSEGKRERKDIEGRLKCKIRIPSEQSLTSAQGSGSLQS
GDQGPTQTTGATGGSPPSDGQQRQTRKFADPQTQTKPDKKPDSLPAKPRIFLNPMSDITK
EEHNVLVNSSNRTLDMSKGQVSRDLLRVGGPQLQEECKTKYPNGINFGEIAVTGKGGPKG
LFCKNIFHCCLKEEKDKKKIEKIIKETTIKCLDKANEMGHSSIGFPAIGTGTLKFPPRTV
AEAMFKAIIKFGRQNPDCSVNDVVIILHKKDQEVKKAFQEVKEEYTAVTEDVASDLQTNP
NLKGSKSYSFFEETSRPLTLVFVGLDEGVTDQAAAALLDVYKAAIRKHSVDAPFLQYWDD
FHVSQLVHACKVAMVDLTFNFELDRIVLGGFTTDIDRVPYSTIMKEAEEYLQQKKFVHLI
SKQVRWNWVEVDMTGKRLIPYDDTNNYMIEMNYRDGKPSVFVYDTNNQGFMIRFHTMDEI
PELLPNTEDQEDSVEVFRHDLIHDVPNAPLPPHWTPMGNDDLFAEVPLKEDSSDYTRTAN
LFRTSYGQPHLVIEKIARIQNPTLYRQYMAKMMELKNSLPENALVERKSLWHGTKSDCVT
SIVSLGFNRSYSWQKDQDNAYGDGVYFATSAQYAARQEYAAADGLGSRHVFLCRVLVGQY
TQGARGMRFLPEIPNSRGRCYNSAVDDQADPTMFVIFNDTQAYPKYLIVFK
NT seq 4476 nt NT seq  +upstreamnt  +downstreamnt
atgatggaatccgagcaggaagatgacttcttgtttgtcttcacagaagaggcatctttg
gacacgtctctgatatcagtcatgtccgccattcgtgtggatggagtacttcccagcatg
tccatggactacattcagctgcactttgagagcaaaaagaaatctggaggaggggacata
gtgcagtcacatgactttcgtagcaaaggctttgtgattttcgtttatgaaacttctgaa
gttgtgaaggaagttttgaaacgaccccaggtaatcgacggacatcatctgaaagtgagc
agatacgaagaacacatacctgcacaagaaacagatatcgtccaagagaagctggaaaag
ccgaggactgtgagtgtccggggtgtgccgacaacattcagcacagagattgtcacttac
tactttgagaacaaacgtcggtctaaggggggaccagttgagggggtcacaaaatctctc
gaggaagatgttttcttcgtcaagttcgataaccctgaagacgcagctcgtgtggcatcg
catgaacacattctagagggacgaaagctccaagtatgtatctacactccaccacagatg
attcccgatcgtctgctcgtgcgaggtctcccagacgtgagcgttggcgaggagctgaag
ttgtacatggaagctagaagcgacactgacgtggactctattctatatggggatggaggt
gtggcggttgtcatctttgctggcaatattgatattcagaagttacaggaaggtttcaaa
aagagacagttcaaaaatgtgacgctggaagttgaacccatcccatgcatgtgcacaatt
caggtgtataacttacctgaaaagccctctccctcggaagacatgttgagaaactacttt
gagagcgaacacagcagcggtgggggtgaagtgacacgtgtgcagattgacgaaaagaga
aactatgcattaatcacctttaaggatgctacagctgcatcaaaggctctcagtcgaagc
cacactatccaaggaaaaaaggtagagttgttgcctttttacacctgtctcggtcctacc
ggtggaaggtccagtcctcccgttaagatcccggggaagcaaagtctttccgaaactgcg
cgacaaaagatcgttcacctgaaaggaatccatgaactgtggcaggagtttgactcgttg
ttacaacaacaccatgcttgttttatagaagcttgttctacagaatccgtttacattgaa
tgcagcctgactcaggatacagcaggagtccgtcagcttgcggcagcatggacacaggat
gcgaagaacgccgttgaagactatctgagcaagattacaatagaagaggtcatggtcatg
tcaaaggtattttcagaaacaggagccaccatcagagatttggcagaaagggcaggtgct
ttcataaaatatgactcaactcaaggtctattatttcttatcactaaggaggccagtact
gatctggtgacggatataaagaaaacctttgctgaagccgaagagatgttgaatagaaag
tccagagaaagatgcgaagactttcctttagaagtacgcacatacgatttctttgtaaag
aaccacgtaaaaatgaaggaaatccaagagacgcattcaaagctaaaggtttgttatgat
catcagaggaagatgctaagacttacaggatccgaagctgaaatagaggaggtgaagaaa
ttttgtcaaagaatcgccatctgtcaacatatgtgggacaatgaggccacaagagagtta
tttcgtcaccccgaagctcaaaaagttattcaaactgtctgcagagagtcagatccagaa
ggagatgttgaatttacagaagacggcgtagttatttattccctcgacaaaaataaaatg
ggaacgatgaaagaaacttgcttggggcacgttcgtagggaaaagattgttctctccgaa
gaatttggagaagcttgcaaaacagataaatggaaaaaattcaaagaaaaatttcagcag
cttggtaaaggaactgttcttatcaaagaagaacagacaaacttgattgttgttggcgtt
ggctcaaaattcaatatttgctacgaagaagcaaaaaaattttttcaagaaaacgtcttc
ttaaagagaactttctttattgaagacgaggatctggcccctttgtacaaatacagcatt
caggattatgtagcttcgaatatgaagctaactgctaaagaggttctattgggaaaaggt
tgcctttctataacagggaatatgctagagatttcagcttttgaacgggctatggagagc
ctgaacacgaagaaaacgttgaaggaaaaaacatttaatgaaccatctttgtttcggttt
ctcaaatcttccgagggaaaacgagaaaggaaggatatcgaaggaaggctaaagtgcaaa
attcgtattccaagcgagcaaagcttgacgtctgctcaaggtagtggtagtttacagtcc
ggtgaccagggaccaacgcagacgactggggcaacaggtggttctcctcctagcgatgga
caacagagacagacaagaaaatttgcagacccccaaacacaaacaaaacctgacaaaaaa
cctgacagtttacccgcaaagcccaggattttcttaaatcccatgagtgacatcacaaag
gaagagcataatgtgctggtgaactccagcaatagaaccctggatatgtcaaagggtcaa
gtgtcgagggacttgttgagggttggaggacctcagctgcaagaagaatgcaaaacgaaa
tatccgaatggcattaattttggagaaatcgcagtcactggcaaaggaggtccaaaggga
ttgttctgcaagaacatctttcactgttgcttaaaggaagaaaaggataaaaagaaaatc
gaaaagataatcaaagagactacgatcaaatgtctggataaagcgaatgagatgggacac
tcttcaatcggatttcctgccattggaacagggactttaaagtttccacccaggaccgta
gctgaagccatgtttaaagccattatcaaattcgggcgccaaaatcctgactgtagtgtc
aatgatgtggtaattatcctccacaagaaagaccaggaagtcaaaaaggcattccaagaa
gtaaaagaagagtataccgcagtaacggaagatgtcgccagtgatttgcaaaccaaccca
aacttgaaaggaagcaagagttattcgttctttgaagaaacctcgaggcctttgactctg
gtatttgtgggactcgatgagggtgttacagaccaagcggcagcagcacttctcgatgtg
tacaaagctgccatcagaaaacattccgtcgatgctccctttttacagtactgggatgat
tttcacgtcagccagctcgtgcatgcttgcaaggtggcaatggtagacttgactttcaat
ttcgagttagacagaattgtcttgggtggtttcacgacagatatagacagagtaccctac
agcaccatcatgaaggaggcggaggaatatttacaacagaaaaagttcgttcatctgatt
agcaagcaggtgagatggaattgggtggaggtggacatgactggaaaaaggctgattcca
tacgacgatactaacaattacatgattgagatgaattacagagatggaaaaccctcggtg
tttgtttacgatacaaacaaccaaggctttatgataagatttcacactatggatgagatc
cctgaacttctcccaaatacagaagaccaggaggactctgtggaagtctttcgccatgat
ctcattcatgatgtaccaaatgctcctctacctccgcattggacccctatgggcaatgat
gatctctttgctgaagttccactgaaagaagattcttctgactatacgaggaccgccaat
ctcttccgcactagctatggacagcctcatcttgtgatcgaaaagattgctcgcatccag
aacccgacactctacagacaatacatggctaagatgatggagctcaaaaactctctaccc
gagaatgctcttgtcgagcgaaaatcgctgtggcatggcacaaagagtgactgtgtcact
agtatcgtcagtctgggcttcaacagaagctacagttggcaaaaagatcaagacaacgct
tacggagacggcgtctacttcgccacgtcagcgcagtacgcggcacgtcaggaatacgcc
gcagctgatggtctgggaagtcgacacgtgtttctgtgccgggtgcttgtgggccagtac
acccagggtgcgagaggcatgcgctttcttcccgaaatccccaactccaggggaaggtgc
tacaacagtgctgtcgacgaccaagctgatcccacgatgtttgtcatcttcaacgacact
caggcctacccgaaatacctgattgtcttcaagtag

DBGET integrated database retrieval system