KEGG   Pomacea canaliculata (golden apple snail): 112563898Help
Entry
112563898         CDS       T05881                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcan04131]
    112563898
Membrane trafficking [BR:pcan04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    112563898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2 zf-RING_UBOX zf-RING_5 WD40 zf-RING_11 zf-RING_2 zf-C3H2C3 zf-C3HC4
Motif
Other DBs
NCBI-GeneID: 112563898
NCBI-ProteinID: XP_025094139
AA seq 865 aa AA seqDB search
MATYASATSTKKQEDREEANSSSEEEEDEDGDDTESEEEPDEPKLKYERLTNDLNAILSK
DAASCIAVHTKFLALGTHWGMIFILDHTGNNIRDKEIMAHTTTVNQISIDEKGEYLASCS
DDGKVMIAGLYGTELNQTVSFDRPVKSVGIDPYFTKSGRGRQFACGEEKLVLNEKSGLFR
TNKAITIHQGEGPVRNIKWHTDFIAWANDEGVRMYHTSSRRIITKIAKNHKHRTDLYGCQ
LCWKDDVTLLVGWADTVRVCVVKVKPVHDGLDTPRHIVEIVQTFTPDFFVCGIAPLGSNL
VLLTYDKDGMKQEGGKMVCKRPHLRIIEPGLYTSEELSNDALTMRGFEEYRINDYHLECI
PDENIFFIISPKDVVISRLRDMDDHITWLMDHERYEEAMACASDHAHELKSHTYEAIGRT
YLDFLVHQQKFAEAVKMCVKILGKRKDLWEEEIYKFAKIGQLRAISMCIPLEDPRLSPAI
YEMILNDFLQRDYAQFYHLIKTWPHDLYNKEALINAVVNLLDRELDQELLLQSLGQLYAY
QKAFDKALAIYLRLKNKEVFGLIQKHSLYTAVSDKIQALMELDWEQATRMLLDNIDKIPV
KKVISQLSKNHYFQYVYLDQLYTKDISAVHDYGHQMVELYCEFDRPKLLPFLRRSESYPL
QKALEMCELRGYVKEQVFLLGRMGNLTQALKMIMEGLGDVNHAIDFCKEQNDEELWENLI
SYSIDRPNFITALLQNVGADIDPIKIISRIEKGLVIPGLRDSLVKILQDYNLQISLREGC
RRILVADSFNLLERNVRTQRKAIFVNESQMCPVCGQELIVNDLRLASNILVFNCRHTYHE
DCLPTAVTNCTMCSSQKKGPGSKGF
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctacgcgtctgcgactagtacgaagaaacaagaagatagagaggaggccaat
agctcatctgaagaagaggaggatgaagatggtgatgatacagaatctgaagaggaacca
gatgagccaaagctgaaatatgagcgtctgacaaatgacctgaatgccatccttagcaaa
gatgcagctagctgtattgctgtccatacaaagttccttgctctggggactcactggggt
atgattttcattcttgaccacacagggaacaatatccgggataaagaaatcatggctcac
accaccacagttaatcagatcagcattgacgagaagggagaatacctcgccagctgttct
gatgatggaaaggttatgatagctggcttgtatggcacagaacttaaccagacagtgtcg
tttgaccggcccgttaagtctgtgggaatagatccttatttcaccaaatcagggcgtggc
agacaatttgcttgtggagaagaaaagctggttttgaatgagaagagtggtctcttcaga
accaacaaggccataacaatccatcaaggggagggacctgttcgcaacatcaagtggcac
acagattttattgcatgggctaatgatgagggagtcagaatgtaccataccagttctagg
cgtataattacaaaaattgccaaaaatcacaaacaccgaactgacctttatggctgccag
ctatgctggaaggatgatgttactctccttgttggttgggcagacactgtcagggtctgt
gttgtaaaagtaaaaccagtacacgatggactggatacaccacgacacatagttgaaatt
gtccagacatttacccctgatttttttgtgtgcggcattgctcctttgggaagcaatctg
gtacttctaacatatgataaagatgggatgaaacaggagggaggcaagatggtatgcaag
cgtccacatctacgaataatagagccaggcttgtacacatctgaagagttgtccaatgat
gccctcaccatgagaggatttgaagagtaccgcatcaatgactatcatctggagtgcatt
ccagatgaaaatattttttttataattagccctaaggatgtggtcatatcaagacttcga
gatatggatgaccatatcacatggcttatggatcatgagcgatatgaggaagccatggca
tgtgcatctgaccatgcccatgaactgaaatcgcacacatatgaggcaataggtcggaca
tacttagacttcctagtgcatcagcaaaaatttgctgaagctgtcaagatgtgtgtgaag
atccttggaaagaggaaagatttgtgggaagaggagatatacaagtttgcaaagattggc
cagctcagagctatctctatgtgcattccacttgaagacccaaggcttagtcctgccatc
tatgagatgatccttaatgacttcctgcaacgggattatgcacaattctatcatcttata
aaaacctggccacatgacctgtacaacaaagaggcattgatcaatgctgtagtaaatttg
ctggatcgtgagttggatcaagagcttctactgcagagtcttggacagctatatgcctat
caaaaagcatttgacaaagctttagcaatatacctcaggttgaagaacaaggaggtgttt
ggactgatccaaaaacactcattgtacactgctgtgagtgataagatccaagcgctgatg
gaactggactgggaacaggccacacgtatgcttctggacaacatcgataagattccagtg
aaaaaagtgatcagtcagttgtcaaagaaccattactttcaatatgtgtatttagatcag
ctgtacactaaagacatttcagcagttcatgattatggccatcagatggtggagttgtac
tgtgaatttgacagacccaagctgttaccattcttaaggcgcagtgagtcatatcctctc
caaaaagctctggagatgtgtgagctacgtggatatgtcaaagaacaagtcttccttctt
gggagaatgggcaacctgacacaagcattgaagatgatcatggaaggtcttggggatgta
aaccatgccatagatttttgcaaagaacaaaatgatgaagaactatgggaaaacctcatc
tcttactccattgacagaccaaactttatcacagcattgctacaaaatgttggagcagac
attgatccaatcaaaatcatcagtcggattgaaaagggccttgtgattcctgggttgcgt
gattccttggtcaagattttgcaggattacaatctacagatttcccttcgtgaaggctgt
cgtagaatcctggtggcagacagtttcaatttgctagaaagaaatgtcaggactcagcgg
aaggcaatatttgtgaatgagtcacagatgtgtcctgtttgtggtcaggagctgatagtc
aatgatcttcgccttgccagcaatatacttgtgtttaactgtcgccacacctaccatgaa
gattgcctgcctactgcagtgacaaactgtacaatgtgcagcagtcagaaaaagggacca
ggaagcaaaggattttaa

DBGET integrated database retrieval system