KEGG   Pomacea canaliculata (golden apple snail): 112564018
Entry
112564018         CDS       T05881                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC112564018
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pcan03036]
    112564018
Chromosome and associated proteins [BR:pcan03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    112564018
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3 DUF4207
Other DBs
NCBI-GeneID: 112564018
NCBI-ProteinID: XP_025094331
AA seq 579 aa
MSASGGQTSSKTLTAGSMTGGSQGGSGSGRAGALPLRRRRAKVTNEKKIADDEFMAAAIG
DVEWLKQSLREVGSQIVFDKNGLAALHLAAIHGRLECIKLCIEKFKQDVNLASSTGWRPV
HLCISNQTGKRSLQCLTYLLEKGADSSIANDDGITPVHQAASEGHVQCLKFLIEVGAKID
GKDCRGNTPLDLAKLWGHRKCARILAAEMWHQDKNNVAQEMRQLKKLKMQQVLRELEEEA
EVQAAHQFYGQQAYEQWLSTRGLRVTKTGLVKTDSPKAQAKPGKKPTVTIREPLMKPNSM
AVRGPQEVVAESGAITMSVSVGKKVSTSSKPSRLDTATTMMSELDAGLYGHGEQREPSAK
VEARTVSPDYYNPNKWNFSPKTPXTAYVPILKDEYPRDEYTLMPKTGDVKYFDGKHAKEE
SDSGEKKVGATEKNLRKPNLPQEVIEREMSKDPSLFDRPILFKPRHIDDVHKKKKYAREE
KPLSEAPLHLCNDVTSDLVKLSVLFNPHSEKPSLKPQKSAGKASRQTSGNSESSHPNGPS
YSCPLPELLTTLKLMQKPDHYPPIRGKEYDIRMDNVVVH
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgtctgcgtcgggtggtcagacatcttcgaaaacacttactgctggaagtatgacaggt
gggtcacagggagggtcggggtctggacgagcaggagcactaccgctgcgcagaagacga
gcgaaggtgactaatgagaagaaaatcgccgacgacgaatttatggctgcagctatcgga
gatgttgaatggttgaaacagagcctacgagaagtcggatcgcagatcgtcttcgacaaa
aatggccttgctgcattacacctagctgctatacatggtcgcttggaatgcataaaactg
tgtattgagaaattcaagcaggatgtcaacctagccagctccacaggctggcgacctgtg
catctctgcataagtaatcagactggaaagcgctccctgcagtgtctgacttatctgcta
gagaaaggagcagattcttccattgcaaatgatgatggaataacaccagttcaccaagca
gccagtgaaggccatgttcagtgtctgaagttcctcattgaagttggtgccaagattgat
ggcaaagattgtcgtggaaataccccactggatcttgctaagttgtggggacaccgcaaa
tgtgcaagaattcttgcagcagagatgtggcaccaagacaaaaacaacgtagcccaggag
atgcggcagctgaagaaactcaagatgcagcaggtccttcgagagctggaagaggaggca
gaagtccaggcagcccaccagttctacggccagcaagcctacgagcagtggctttccact
cgtggattgagagtcacgaaaacaggtctggtaaagactgactcacccaaggctcaggct
aaaccaggcaagaaacctaccgtcaccattcgcgagcctctcatgaaaccgaacagcatg
gccgtccgaggtccccaggaggtcgtagcagaaagtggcgccatcaccatgtcagtgtca
gtgggcaagaaggtctccacgtcttctaagcccagccgtctggacacagcgaccaccatg
atgtcagaactcgacgctggcctgtacggtcatggtgagcaacgagaaccaagtgcaaaa
gtagaggcaagaaccgtctcgccggattactacaatcccaacaagtggaacttctccccg
aagacaccangcacagcttacgtccccattctcaaggacgaataccccagggatgagtac
accctgatgccgaaaacgggtgacgttaagtattttgatgggaaacatgcgaaggaagaa
tctgacagtggtgagaagaaagtaggagcgaccgagaagaatttgcgaaaaccaaatctt
ccacaggaggtcatagagagagagatgtcgaaggatccttctcttttcgatcgaccgatt
ctgttcaagccgaggcacatcgatgatgttcacaagaaaaagaagtacgcacgcgaggag
aagcctctcagcgaagctccgcttcacctgtgcaatgatgtcacctcagatttagtcaag
ttgagtgtcctcttcaatccacattctgagaagccgagtctgaagccccagaagtccgca
gggaaggcctcgcgccagacttccggtaactcagagagcagtcatccgaatggcccttcg
tactcctgtcctctacccgaactactcacaacactgaagctgatgcagaagcctgaccat
tacccacccattcgtggcaaagagtatgacatccgcatggacaatgtggtcgtccactga

DBGET integrated database retrieval system