KEGG   Pomacea canaliculata (golden apple snail): 112565134Help
Entry
112565134         CDS       T05881                                 

Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112565134
Enzymes [BR:pcan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     112565134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 112565134
NCBI-ProteinID: XP_025096225
AA seq 477 aa AA seqDB search
MKYCSTRGKVSGLSFEDVLFSGYLADGGMALPEVIPEVPSETLKSWVGLSYKELVQKIVP
LYVSQEELPLVVLEELVGQALSTFDVPEIIPIVCFPGGLNIMELFHGQTWAFKDLAMSIL
GQFFNFFLNKRQKHLMLVVGTSGDTGSSAIAAVRGLKWVDIVVVLPRDRCTLIQELQMTT
VKEDNVFVFRADGSSDDLDVPIREIFDDADFVKKHHLCSANSLNWARIMVQIVHFFYAYI
KLCPECDQELEIVVPTGGAGNITAGFIAHKMGLPVKLVCVANSNDGIAQMVGSGFYKLSN
VKPSLAPAMDIKFAYNIERLWYLCSERNSELVRKMMEEVEMEGKVETPDSILEELQMVLS
AYGADDEDIKRTLRQCWEENHYLLCPHSATAVAYYYKKQASVHNLSQLSVCFATASPLKF
GEALTAAGLKPISTEAIQKLMQLPTQYVDMELTDDWKAMLREKVEEMTASFNLRNKQ
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactgcagtaccagagggaaagtttcagggctgtcctttgaagatgtcctcttt
tctggttacttggctgatggtggcatggcactgccagaagtcattccagaggtgccctca
gaaacactcaagtcatgggttgggctttcgtataaggaactagtgcaaaagattgttcca
ttatatgtctcgcaggaagaattaccactcgttgtcttggaagaactggtgggacaagct
ctctcaacatttgatgtaccagaaattattcctattgtttgttttcctgggggcttaaac
ataatggaactatttcatggacagacttgggctttcaaagacttggccatgtctattctt
ggacagtttttcaacttttttcttaacaaaagacaaaaacatcttatgctggttgttggt
acatcaggggacacaggcagttctgcaatagcagctgttagaggcctcaagtgggtggac
atagtggttgttttacctcgtgatcgctgtactctgattcaagaactgcagatgaccaca
gtcaaggaagacaatgtttttgtcttcagagctgatggaagctccgatgatcttgatgtg
ccaatcagggaaatatttgatgatgctgattttgtgaaaaaacaccacctttgctcagct
aattctcttaactgggcacgcatcatggtgcagattgttcatttcttctatgcatatatt
aagctttgtccagaatgtgaccaagagctagaaattgtggtaccaacaggtggagctggc
aacattacagctggttttatagcacacaagatgggtcttccagttaaacttgtatgtgtt
gccaactccaatgatggcattgcacaaatggtaggcagtggcttctacaagctttcaaat
gtcaagccatcattggcacctgctatggacataaagtttgcttacaacattgagcgccta
tggtacttgtgctcagagcgcaattcagagttggtcagaaagatgatggaagaagtggag
atggaagggaaagtagaaactcctgacagcattttagaagaattgcaaatggtcttgagt
gcatatggagctgatgatgaagacatcaaaaggacactcagacaatgctgggaagagaac
cattaccttctctgtccacactctgccacagcagtagcttactattacaagaaacaagct
tcagtacacaatttgtcacagctttctgtgtgtttcgctactgcatctcctctgaaattt
ggagaagcactgacagcagcaggactaaagcctatttctacagaagccatccagaagctt
atgcagttaccaacacaatatgtagacatggaactaacagatgattggaaggcaatgctg
cgggaaaaagttgaggaaatgacagcatcttttaatctccgaaataagcagtag

DBGET integrated database retrieval system