KEGG   Pomacea canaliculata (golden apple snail): 112567142Help
Entry
112567142         CDS       T05881                                 

Definition
(RefSeq) heat shock protein 70 B2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan03040  Spliceosome
pcan04141  Protein processing in endoplasmic reticulum
pcan04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112567142
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112567142
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112567142
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcan01009]
    112567142
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pcan03041]
    112567142
   03009 Ribosome biogenesis [BR:pcan03009]
    112567142
   03110 Chaperones and folding catalysts [BR:pcan03110]
    112567142
   04131 Membrane trafficking [BR:pcan04131]
    112567142
   03051 Proteasome [BR:pcan03051]
    112567142
   03029 Mitochondrial biogenesis [BR:pcan03029]
    112567142
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcan04147]
    112567142
Protein phosphatases and associated proteins [BR:pcan01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     112567142
Spliceosome [BR:pcan03041]
 Complex B
  Other components
   Prp19 complex
    112567142
 Complex C
   Prp19-CDC5 complex
    112567142
Ribosome biogenesis [BR:pcan03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    112567142
Chaperones and folding catalysts [BR:pcan03110]
 Heat shock proteins
  HSP70 / DNAK
   112567142
Membrane trafficking [BR:pcan04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112567142
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    112567142
Proteasome [BR:pcan03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    112567142
Mitochondrial biogenesis [BR:pcan03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    112567142
Exosome [BR:pcan04147]
 Exosomal proteins
  Proteins found in most exosomes
   112567142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A StbA
Motif
Other DBs
NCBI-GeneID: 112567142
NCBI-ProteinID: XP_025099490
AA seq 637 aa AA seqDB search
MAKAPAIGIDLGTTYSCVGVFRHGQVEIIANDQGQRTTPSYVAFTDTERLVGDAAKNQAA
MNPENTVFDAKRLIGRRFDDSSVQADMKHWPFKVVNDGGKPKIQVQYKGETKTFAPEEIS
SMVLVKMKETAEAYLGQRVKDAVITVPAYFNDSQRQATKDAGNIAGLNVLRIINEPTAAA
LAYGLDKNAKGEKNVLIFDLGGGTFDVSVLQISEGSLFEVKSTAGDTHLGGEDFDGRMVQ
HLCQEFQRKYKKDISKNARAIRRLLTACERAKRTLSSSAEASIEIDSLYEGIDFYTRITR
ARFEELCADLFRKTLEPVEQALRDAKLDKRQIHEVVLVGGSTRIPRIQKMLSEFMGGKEL
NKSIHPDEAVAYGAAVQAAVLSGDTSDSIRDVLLVDVAPLSLGIETAGGVMTKLVERNTT
IPNKTSQIFTTYADNQPAVTIQVYEGERALTKDNNLLGRFELTGIPPAPRGVPQIEVTFD
IDANGIMTVTAQDKSTGKSSNIIIKNDKGRLSKEDIDRMVNDAERFREEDEKQRKRVEAR
NRLESYVFNVRQAVCEAGDKLSSADKDTVNTACDEAVSWLDNNTLAETEEFEHKQKEVQK
VCSPIMTKLHGTGQSGPSFNQGRTPPSTGGPTVEEVD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagcaccggcaatcggcatcgatctcggcaccacctactcgtgtgtaggtgtg
ttccgacacggacaggtagagatcatcgccaacgatcagggccagagaactactcccagc
tatgtggccttcaccgacacggagaggctggtgggagatgcggcgaaaaaccaggcagcc
atgaaccccgaaaacacagtctttgacgccaagcgactgatcggcaggcgttttgacgac
agcagcgtgcaggcggacatgaagcattggcccttcaaggtggtcaacgacggcggcaaa
cccaagatacaggtgcaatacaagggcgagaccaagacgtttgcaccagaagagatcagc
tccatggtgttggtcaagatgaaagagacggccgaggcgtatctgggtcagcgtgtcaag
gatgctgtcatcaccgtgcctgcctacttcaacgactcccagcgacaagccacgaaagat
gcaggaaacatcgccggcctcaacgtcttgcgcatcatcaatgaacccacagccgccgcg
ctggcctacggactggataagaacgcgaaaggagaaaagaacgttctcattttcgacctg
ggtggcggcaccttcgacgtgtccgtcctgcagatcagcgagggctcgcttttcgaagtg
aaatccacagcaggagacacgcatctgggtggcgaagactttgacggccgcatggtgcag
catttgtgccaagagtttcagcgcaagtacaagaaggacatcagcaagaacgcacgtgca
attagaaggttgctgacggcgtgcgagcgcgctaagcgtacgctgtcgagcagtgccgag
gccagcatagagatcgactctttgtacgagggaatcgacttctatacgcgcatcacccgc
gcacgctttgaagaactgtgtgccgacctgttccgtaagaccctggagccagtggagcag
gcactgcgcgatgccaagctggacaaacgacagatccacgaagtggtgctggtgggcggc
tccacgcgtattccacgcattcagaagatgctgtcggagttcatgggtggcaaagaactg
aacaaatccattcatcccgacgaggctgttgcatacggagcggccgtgcaggcggcggtg
ttgagtggcgacacgagcgactccatccgcgatgtgctgctggtggacgtggcgcccttg
tcgcttggcatcgagacggctggcggcgtcatgaccaagctggtggagcgcaacactaca
attccaaacaagacatcgcagatcttcaccacctacgccgacaaccagccggccgtcacc
atccaggtgtacgaaggtgagcgcgccttgacaaaagacaacaacctgctgggtcgcttc
gaactgacgggcatcccacccgcccctcgaggtgttcctcagatcgaggtgacctttgac
attgacgccaacggcatcatgaccgtcacagcccaggacaagagcacgggcaagtcttcc
aacatcatcatcaagaacgacaaagggcggctgagcaaagaggacatcgaccgcatggtg
aacgacgccgagcgattccgggaggaggacgagaagcagcggaagcgggtggaggcgcgc
aaccgactggagtcgtacgtgttcaacgtgcgccaggccgtctgtgaggcgggtgacaaa
ctgagtagcgccgacaaagacaccgtcaacacagcatgtgacgaagctgtgtcgtggctg
gataacaacaccctagcagaaacggaagagttcgagcacaaacaaaaggaagtgcagaaa
gtgtgttctcccatcatgactaagctccatggcactggccagtctggtccatcatttaat
caaggtcgcacgccaccgtctactggtggacctactgtggaggaggtggactga

DBGET integrated database retrieval system