KEGG   Pomacea canaliculata (golden apple snail): 112570126Help
Entry
112570126         CDS       T05881                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcan01001]
    112570126
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcan04131]
    112570126
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pcan04812]
    112570126
   04147 Exosome [BR:pcan04147]
    112570126
Enzymes [BR:pcan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112570126
Protein kinases [BR:pcan01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   112570126
Membrane trafficking [BR:pcan04131]
 Others
  Actin-binding proteins
   Others
    112570126
Cytoskeleton proteins [BR:pcan04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     112570126
Exosome [BR:pcan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112570126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N fn3_4 C2-set_2 BiPBP_C DUF2369 C1-set Ig_C17orf99 IQ
Motif
Other DBs
NCBI-GeneID: 112570126
NCBI-ProteinID: XP_025104157
AA seq 10936 aa AA seqDB search
MSLSPTSLMSVDLSFDEMEFLRPSGRPPVEEKVPLPPVLPKPVAKPHLQHLSCLRWRFQQ
RNTRGLVLLRLRNGLTSQKEYQAPPAKVPKPAEAPAPKPTAPPVPASKQQFFIPREKSPS
YEIQETGPVQLISYASDTECGYLRLMDEQDLERPPFFEKRQLSEPPVMPEKRKPEQLPVI
APKPVAPVKVPPAVAPKPKPPSRPVVPAQVQQPEPQPPLLKPEPVTTTLQFQPKEKEYRH
VEPPKSKPEPVKHVVTFAAPPPPSPPSAPVVKAAPSPLPPTAPKPTQVAPTQPKAPRVRV
RKQASHEAKVPIVLKQEPTPWWPEHIDVPMVVEEVEKRDSEEFESAVREYIRREGQAPPL
EDLYDKTKGRPPKFKTQIKDLLTLKENEPAHFECKLVPIGDPTMKVEWFKDGEPLHHGTR
YKPEYDFGFVSLGIQWVNPEDSGVYTCHATNNYGEDSTSATIKCKALRSIIMDTQLPGEG
ATRLQEMEEHWRSQMILEERYLEEPQTRSPPLFDLKPEPVETGEGEPAKFLVKVGGFPRP
RVSWWINGSLIVSGTRFKLTYDGMMHHLEIPRVREYDAGQIRVVAKNSEGEAECSTSLQV
LPREDWRARLRQAPKGELEIELERRRKIELRSVELDKAFKKPKATEFELRQLERAAETKI
RVQKDQEVITTERQYISVHSQLRHLEPSMQAEPVFVRQVTVETIRPEEPSKVSEQQITLE
RGQPPVFTKPLRPVRVPEGSGVTLEVTYTGIPPPIISWYRDSFEIQPSRDFQITTTENSS
TLHIPEVFLEDSGVFSVKAYNKFGQVQCKAKLTVVEAEEPQREISPEFRSLMRDSVVTQG
EPATFDCQVAGNPSPKVHWQKDGRPLGESHRWKFIDEDENHTLVIYEVRPEDAGLYACVA
INSVGKSTCTARLTIEIPIQPPEQLGPTPQLESKIEAPFVMEEPRSVEVEEGEPVKFTCR
ITGRPAPVVTWYRNNQLVKPSKYFQMSSTTEGVHILSIMEAFPEDTGTYKCVARNKSGEV
ACITVLKVHGLESEPEPSQPMATAQPPSFIKPVANTMVPEGTPARFEAVFSGYPTPDISW
IRNGIQTLHSSREYKIETKDSLTSLTIFKAMPEDTGLITCRAKNQAGTAECSAELYVQQV
PESTETAAPLVARDEITVTLEGLEAPATETVAPERFEVTAVETIAEKPVETEDVSPKLVT
RETAEAISREETQEEAPLPESQEAAKEFTTAERFETLITEIEEAFVEVYQQEASEVVEEK
ELEKPSVSGVSLIESVPEEEEEGFEVVGLPQVEESQEEVVLKGHAPTFLQPLHNVEAVEG
QPVCFETTVTGFPQPEVTWFLDGEPIKESPVYHIVADATGLCILELHESFPEDEGEYECR
ASNKFGTASTKADLYIQERAEEKDETLVVEEILSEKEKLVTAEEEKDEVSDEERKEETLE
ELKPHVAEVEELRFAPEIRMGLEDISTLDGGQAQFTAKIVGVPQPEVTWYKEEDVIFSSE
VFEIIQDDENNFILFIHDVMPEDAGRYSIVAKNEMGTATSSAQLTVTAEEVIEEARPEDI
SGLAPEFIEKPRFQSVEEGTTVIFKAIVEAIPQPEIHWTKDSGELPEDERYQVMVTQGIT
STVHHISLTVADVTPQDAGTYRVTASNQLGEESVAVSLIVNQLTEVKKDFRDQLQRADLE
IPEKPISVDTEQVDLRGQLKSEVKTRVGIIYESQQIDFRNLLRKTDQKAKKFEADLTTAE
TVETTEELLEEQPEQAAIEEVTTEITLPEETRPKFLVPIQDLTIKEGEVARFDCQVKCEP
EATLVWYHLHKPIKSDDIYKIVPGEDGWSSLIIAEAFPEDSGIYTVRAVNSIGENECSAV
LTVEELVSEVSSVESHLDEEQEQPIPETVAEEAAIKIQAAFRGFMAREHVKIMKETKLSL
EHEVIMQEMAITTEDSTIYTPSMDVVPDTTAISSEEVQFSLLEETKPEEKSEVFTVAEVE
EDHIIEEAEKEIIEAPEEISPEIKEEAIEPLEDIVTVKAKAEKDKIPEEVIVEDKMVFEV
EEEEKPLLETAFDIVVEESKKTEITEVTITDQQPEVKEFVLSTSDEDMLPEVIEELEEQG
SLKEETAVVITKTTTPEKAVTDLEALTKVEEVPSVPSETIEDISVRAIPKPETVTYAEEE
TVEVPVAAAALPTEVSTDFILSDTKEQLPEISAETAAEETLEASTAEIKEEEVTLTKSFD
VDQLTQESVEESAGISTEGILPDIVHIEETVRDQAQAEGPIPVEVKEADTGEEEEETAFM
AEIAPQETALQEEKLLEETLVSFVTGHQPTETKEIITTVPEESVQEFREEEAEEYVTEER
EEIEKETTLMKEAEISEVKEELSVMSPELVSELEEEVMEDITVEEEQREESAAVVFDTEA
AEIKESIMTLPLEDTKGIEEVVEQLIRPQGEIAEEEAVFIAETETAKSEEDMVVAPSDGV
QEIKEVTSEAFKEQEEVSETAIAVEAEAETAESKEEISMMPVEEISSLQEDVIMEVVMDL
TEGAEEAQVAIEDIATVQSKEQITQEEMEEMKEFQEEVTPDLVTVQKEEIQPLATATDVE
TTVVREDVTITSFDETQELKDEFISETITEKEEMKEEAFTDVDHVTPAITEEEVITLIEA
DVKELSEEKLPEFGTEEKEHPKESLTVDVAQKTAETKESIVTTVNEEIQELEEEAKPQAI
SELEEQPGEAVTEVVSYEIAKSEEDITVTTVEYVKEVDYAIQETATEQKEETEEALIFVG
ATETADTEETITSVPVEEVKELVEVLLPESVPQQEVEVEEVVAVSLDVETAESKEEVTIE
STEYIEEIQEVTMPEKVTEIEETEKVITGVDDIYPAIAKEETTLSPTEDVGEFEEKIATE
IVTELKEVAEEHMHDIVDAMITETKEGVTGTPFEYVGVIEEEAIPETVIEQKEQLPETVS
VYEETEITKIEEMATEQVEEVIDLYKDEEEIVEEKDTLRETVTAVKDITPTETTPKVTTL
PVEDVEQLEEERAAEALEEQEVVEHISTFVEDMVTSETKEDAAIGDVESVTELEREMYPE
TVEEQEESFAEASLTVEATQVTEVKEETVPSEKEGKLEKVAADEVVPVVEESLQETPTLM
DIPVSDVTPEYRPAEEEITEELVGTEEKLAEVSEEDGSTVISVSDQVVFEAKDVSEKQSE
DLIEKQIDDIISAYPDETTQEDVVTQVMIETKDVLTAFETPESTVEGEGAFDLTERPSPD
DVEEEITLQTVLEQEKIEEAEIDVVIEDHVPTAKLMERPEEDRVDAREDFFLEVEEKPVP
SDTEAEYVISAEDTSTKVAVSMELTEEAAGDKTFAIEISKEEVSVIAEAEEETKEAIITH
ITVEQAPEDTTSATMSISIPSDTEAELTIPAVIARGVDVPGVSEAIDLIQDEQAPDVEGE
IEITLPAQPVQEEVIFEEEEKGPDATDSFTLQTTVPTVEEVAAAITLEAKVPILEEVAEE
ISLSPKVPERMEVAEAITIHTEEAPEAPVTEEVEESVTFEVEHPADKEKEEVSEAVILET
PIPVKEEVAQTVILESKPSAEEAVSEVVAEETLLAPHFDQTLNNQEITEGENVTFEVKVA
GTPKPEITWFRDDVRIQPDERYRMSEEDAIYTFTITGATLDDDAEYTCTAKNAAGSASTT
AELFVNAAGEAPTFISTLTDTKADIGTDVVLECKVKGTPKPEIVWLRSNVELLGDRYQTE
NLEETVRLTILTVNLKIKMNILSRLLTPLVLPHAQQAWLYTLRLPHLRPLEDLAVRVNDT
AHLVCQVKGIPQPEVTWLVDNKPLTVSPRFSTTFEGDEATLEIAEVTLEDTEATYTCHAQ
NIAGEASTIAHLLAQVPAKILSAPSSISTVPGESVVITIHFEGLPAPTPTWAVNSIPLVE
DERHIIQHTATSVTLIIPSADVSDSATFTLTVKNETGQDDVSVDVTVKAPTEEVMPEKPE
GQAPVFVLTIQPQTIEEGETASFTCKVFGSPAPEVTWTQNDQPLKDEGRYMIFEEDGVHH
VEVDEITLKDAGTFTAIATNPLGQVTCSAELQVKEKPVEAAPQTEAPRITIPTKDIEATV
GETIKFFCKATGVPKPDFVWLKDDQEISPTNSEFIIEYTENVETTLTIPNVQPEHDATYT
CKAVNPAGSDSCKAELFVKEFIEEKGFPPEFIKAPHQVVAREHDCAKFLVRVVGMPVPTV
IWKHESQTLEDKELYHFEQYEDTYCFEIKDVEKEDAGPYICVATNSEGEATCEISLIVKE
IPREERLSESPLVLKTQEETRSPQFVEVFQDTSVMEENALQLTCRVTGLPRPEVTWLVNG
HELVVTPNVKTWYDDETVKLKISSTKMDQEGTYTCIATNPAGSAECSAFVTVEGKSEAPT
FTRHLTDRECREGRPVKFECAVKGLPKPQVSWFLNEQPVESGLRFHIDERPSFADIVHSL
SLESTEVEDAGFVKAVATNKAGKATTEAKLLIEEKKESPKFLKKLDNLEVLETETVRLEV
VVSGKPKPQVTWLKGDKELKESEDVHFEVSGETYTLVLDRCTMDSAGLFTARAQNPAGQL
SCNGRLKVIPVKKPTFQRKLSDTLVPEGGVAKFQCQVSGVPMPEITWLLNDEELQPGENI
RCEINPKDGTCTLLITGATPTMQGEIKAVAKNNGGEVLCSAKLDVRGRAPTFVEAPLKCT
VLEGHTAEFRCIIDGVPTPKVEWSKGKWMKLQDGGRNRVFFDESTGEHVLQMEGIKPKDA
GTYTVTATNEHGTEQAPATLMVTDKLEEVVDWKAQLKHREIQREAKEEETAWNIKLKHVE
VEEQKSPSPEVTPKPPSPEIERLEYHPAPKRERPELESEPEPHEFEIKPREHEELEEYLR
PKPVPPQALTAEEEQKTGYVRAVKTREEEELEEKVLIIPKAKWQWIVPLEDLSVKEREAA
KFDCELSIPNVKVVWRVGEQEIEPSPKYAITEDGKTHTLLISKCRPKDSGPVSCAYGDIV
TEANLTVEEVPADFTMKLKDTQAQESTSATFVCLTNDDELPVQWLVNDKPVTPSEKYKIQ
SDGFQHTFTISDLSPDDNCEVTVVIGDNSSSAKLTVEEISVDFSVPLKDVTVTEGNTAEF
QCTLTMPVDKSKVHWFINNKEIQEDEKYEFISDGTIQKLTIKDSTPADAGVVTIKIGEKE
SSASFTVEEIAVDFSIPLKDQTVYEKSIVEFTCELTREVDGVLWFLDEEELKPSDTVEII
KDGPHHKLIIHDVTLEDAGEVKVKVGDLTSSAVLTVQELPVEFVVPLNDVSVMETETAEF
VCELSKDIEKVQWFLDDVELNESDRIEFVKEGLRHKLLVRNSSIDDEGLITVQAGDKKST
ASLFIRDLPPEFIRPLQNQEVNEGDSVIFECELNMDNTTAKWFHDGHEISDDRHYKIVRE
GRVHRLIIIDAILPDAGDITAKVEDKSTTSTLTVHEVPVEFMAELKEIHTEEHKIAYFQC
EVNKDDVTVTWMKDNEVITPSNKHIMEHDERIHTLVIKDVDSNDVAEYAVVVGDRKSSAR
LHLDELPLNLSLSVKRFTVDSESLAVFICNVSKVDLRVSWYRGDRKLHPSFKYEILNEGC
MHKLVVHRLNIEDYDDYIVVIGSRRLTGITLKEEAPLEFTIPLSEQTCKEGETVTFLCEV
TETNVPAKWFKNGMELQPSETMSMEMDGKVHRLVLRDTHMEDTAEYTVIIKDKDSSAKLT
VEEIAADFTLKLNDTEAQEKDTVSLSCEVSKPDVMVDWLLNQEILKPSDKYNMEQDGTTH
TLTIQEVSPDDSGTYTARCGGNETSASLTIKETPLEIIVPLKKTECTEGDSVTLTCEVNM
PDKPARWFKDKTEIFPTEECQLKVEGTVHTLTIPRATLEDEAEYTICIGDKTSTALLLVE
ESPVHITRPLCDTECLEGETVSFVCEVSKPGVPAMWLKDGVPITEDDGFEFITDGCTHIL
KIPEATPDHDAVYTIKINGSKSIAKLFVEEETPDFRARLKDVSGREGDDVELECLLTKAN
IPVRWLKNRKPLTPSDRIKIVCDRYRHMLRIMETIPEDEGEYTVILGDDKESSATLTIYE
IPTQFTKDLRDQEVLEQETIELECELSKKGKPVKWLKDGMEIIPGGRIEIVYDRFLHQLI
IEDATLEDMGRYSCVCGDVSTSANVKVEELPVEILKPLHDVTATEGQPITLECEVSKPNV
PARWLKDGKVLEPSERYHLVVDGTIHKLEIPASELDDEADYTIEVRDKSSKAMVLVEEIA
LEILSPLSDQKVEEKQPFTFTCQVSKPNAKARWLKDGQEITPADDVEISHDGQIHTLTKK
DASLDDKGKYTVVIENKSSSAMLSVTELPTTFVRPLANITVTEHQKLALECEVSRPDKPA
QWFKDDVPVAASARIRLTSEGGVHRLETDSAELDDEAVYRVVVNGAESSAEVFIEELPTT
IVRPLANITVTEHQKLALECEVSRPDKPAQWFKDDVPVTASARIRLTSEDGVHRLEIDSA
ELDDEAVYRVVVSGAESSAEVFIEELPTTIVRPLANITVTEHQKLALECEVSRPDKPAQW
FKDDSPVAASARIRLTSEGGVHRLEIDSTELDDEAVYRVVVNGAESSAEVFIEELPTTIV
RPLANITVTEHQKLALECEVSRPDKPAQWFKDDVPVTASAQIRLTSEGGVHRLEIDSAEL
DDEAVYRIVVNGAESSAEVLVKELPTTFVRPLANITVIEHQKLVLECEVSRPDKPAQWFK
DDVPVTASARIRLTSEGGVHRLIIDCVELDDEAVYKVVIGGNESTAEVLVEEEPVEFTRK
LRDIEVTEKETAVFKCEMSKPDLEAIWLHNGQSVSVEDGFDIKIEKTIHSLVLEDVSVED
AGIYSIKVGDKISEGRLSVKELPVEFTKPLKDLEVIEKMPLVLSCEVNKPDRPAKWQRNG
QDVTPTDHIQITADGCTHTLSISSANLEDEAVYKCIVGDKKSSGRVTVKEEPLTILKPLI
DQTLMEYQPLVLECVVSKPNRSATWYKDGSKLTSSDHLTIISEDKKHILTIDRLAMDDEA
EYSIKVEDLTSKCTVLVEEEDLEFVRKLEDIDVKEIPGTALFECEVNKVSTVAEWFFNNQ
PLTASDKYEMESKGVIHRLKVKDVDGRDEGDYKVAVRGKTSEAGLFVEVPPKIFLDKKYD
ETIYLYAGQSTAFEVPFTGNPQPIVTWTFNEGDLPDKIRMETETIYNMTTIRMSHVKRTD
TGSYTVTLSNDNGKAVISIKLVVLDKPSAPQNVTVTDITAETATVTWETPEDDGGKPITQ
YVIEKREANRQSWKRIGDTPSLQLPVSDLVENAQYIFRVFAQNDVGLSEPTESEIITAKN
PFTVPDAPDAPTVTDVMHDSAVVSWQQPANDGGSPVTGYTIERQSSYSPRWVIVNKTPVQ
NLSLKVDDLIEDNVYQFRVIARNKAGPSEPSKPSDSIVAKDPWNVPGKPGTPDITGTDQS
SVALKWTPPETDGGSPITNYVVQYRPISATQWIQANEAFIVPDTTFSVTGLRENAEYVFR
VAAENRAGAGEPSSPTKPVKVVKPLVGTSPMLLEPLQDTTVVAPGDAILECDIDVGEPEA
EIKWFRGKKEVKKSPKYEMSYEDEVASLVIHKTEPDDADVYRCEASNPLGRVQTEGLLTV
HTHPVLEYDNRLKSAQTIRAGSTLVLKVNTTGIPSPSVSWMLDNEPLQKSDRISIETTDE
YSKLTLKNALLDDSGVYTICAENVVGRAEADFDVKVKDKPGKPNNLHVIEVLKDQIAIAW
EPPTSTGNCPLKGYVIEKRDAKRNTWTPVQRVDNITVMYSVQKLLEGNEYFFRVAAENEI
GVGEAAELFDGIVPKSPYDVPDAPKKLQPSEITHSSVTLTWEPPESDGGSVITGYAVERK
SPASPRWTRVNKSPIRDTVYTVMDLVEGNEYEFRVLAENAAGFSKPSEPTLPIKAVDPYN
KPDAPGRPEAIDINKESVTLKWLPPDSDGGSAIFNYVVEMRVSGSSRWLPASQNIKVPDS
SFIVRQLTKGTEYEFRVSAENKAGIGPPSPPSLPVTARKPLTGEAPTVLEGLPDLAVMEG
DTTVFECKISGEPVPSIKWLKEQREIVEDKRHSMLYDECVASLTVRDTTQKDAGTYTCEA
SNDLGTVTTSGVLEIQAAPTLEFDNKFRDLISLHIGATLKIPVKVGGIPTPQITWAKEEN
PLRPGGRIAISVQDDSTTLTVKKVTKEDDGLITLTAENQVGETKAKFDVEVLDVPAAPEG
PMEVTDITDTSVTLHWKPPKDDGGIDIRSYIIERRDTKRPVWSRMGSVDGVTLDFKATGL
QEGTEYLFRVFAENEVGLSEPLESTTKVIPKSPFDKPDAPEGPLQASDIKEDSVTLTWKP
PKSDGGSLVTGYIVEKRDARKTTWSKVASTDSQMLTCKASKLLSGTPYIFRVMAINKEGM
SLPLESEEVVPQKPPETPGKPVGPIKFSQVLSDSVTLAWTPPKKDGGSPVVAYTIELTDD
AGKNWKHIGTVEAVHTIYTAEGLSEGQDYKFRVCAVNSVGPSEPLVSDSIRPERKIGKPA
KPEGPLEAVDIQRNSVTLKWKPPKEDGGSPLTGYVIEKQDVKYGSWSKVGKVEPTVTEFC
AIDLQEKSNYLFRVMAVNKAGQSEPLEMDKPVTAKSPFDVPGKPKGPLEISNVTDKSADL
KWNPPESDGGSPLTAYIIEVRPDSRSTWTKAGSVDGNSTTFTVPDLKEGTEYHFRVMAVN
AEGQSAPLEAVDTAKPAKKKVPPGPPRDLRAARVGPDYVTLEWKPPAEDGGAKVTQYRVE
KCEETSEEWVKVEDVKSLDTAYKVTDLKEGVGYYFSVSAKNEVGFGEPCETEAAITPKKP
EGPPGPPTAPLTAEDIDKTSVTLSWKPPTEDGGSPLTGYILERRESTRTTWTKLDRIGPD
TLLYKALNLIEGNEYYFRVSAENKHGVSSPLETDSAVKPKSPYDVPSKPRGPLEISNVTD
KSADLKWNPPESDGGSPLTAYIIEVRPDSRSTWTKAGSVDGSSTTFTVPDLKEGTEYRFR
VMAVNAEGQSAPLEAVDTAKPAKKKVPPGPPRDLRAARVGPDYVTLEWKPPAEDGGAKVT
HYRVEKCEETSEEWVKVEDVKSLDTAYKVTDLKEGVGYYFSVSAKNEVGFGEACETAAAI
TPKKPEGPPGPPTAPLNAEDMDKTSVTLSWKPPTEDGGSPLTGYILERRESTRTTWTKLD
RIGPDTLSYKALNLIEGNEYFFRVSAENKHGVSSPLETDSAVKPKSPYDVPSKPRGPLEI
SNVTDKSADLKWNPPESDGGSPLTAYIIEVRPDSRSTWTKAGSVDGSSTTFTVPDLKEGT
EYHFRVMAVNAEGQSAPLEAVDTAKPAKKKVPPGPPRDLRAARVGPDYVTLEWKPPAEDG
GAKVTHYRVEKCEETSEEWVKVEDVKSLDTAYKVTDLKEGVGYYFSVSAKNEVGFGEACE
TAAAITPKKPEGPPGPPTAPLTADDIDKTSVTLSWKPPTEDGGSPLTGYILERRESTRTT
WTKLDRIGPDTLLYKALNLIEGNEYFFRVSAENKHGVSSPLETDSAVKPKSPFNAPSKPR
GPLEISNVTDKSADLKWNPPESDGGSPLTAYIIEVRPDSRSTWTKAGSVDGSSTTFTVPD
LKEGTEYHFRVMAVNAEGQSAPLEAVDTAKPARKISLPGPPEGVHAARVGPDYVTLEWMP
PSDDGGSKITAYRIEKCEETSEEWVKVEDIKSLDTAYKVTGLKEGVGYFFSVSAKNQVGF
GEPCETEAVIKPKKPEERPGPPTGPLLVSDIDLTSATLTWQPPQDDGGAPITAYIVERRE
SGRSKWTTLDHLDADTLTLKAINLIDSCDYYFRVMAQNRIGLSEPLETEKSVKPQSPFTK
PSKPVGPLEISNVTDKSADLKWNPPESDGGSPLTAYIIEVRPDSRSTWTKAGSVDGNSTA
FTVPDLQADTEYHFRVIAVNAEGQSSPLEAKDTAKPVKKIVPPGPPSSLRVSKIGPDFVT
LDWKAPLEDGGSRISGYRLEICDESSDQWVKLADLKAFDTNFKVTNLKDTVSYLFAVSAQ
NAAGYGEPCETETAVSPKKPEGPPSKPVGPLKAKEIERTSIALEWQPPTSDGGSPIAGYI
LEKRDSGRPTWTRVEKLMPNKTSYKVQNLLEGSEYYFRVSAENKHGTSEPLETEVTVKPK
SPFDKPSKPTGPIRFSDVTKDSITLSWQPPDSDGGLPINKYNIEYRDTRRTAWVKAGSVS
KENTSFTCADLIEGNEYIFRVTALNDEGESPPLESKETVKPQREITTPSSPANISIKDTG
KDFITVEWSAPKDNGGSKVTGYTVMYRDEDSDDWTQAGSVGSLETSFTVKDLSLDKKYYF
AVAGENKKGLGDRIETTSPASPKKPLQKPSPPEGPIKFTDIQRTSVTFTWGPSPYDGGTP
VTNYILEMRETWKITWSPVTIVKPDITSYCVQNLKEGTEYFFRVIAENAVGKSEPLESDG
VVPKNPYAPPSMPEGPLEACDITANSLTLNWKPPLTDGGQPLTGYLLESRDVRRPVWSPV
ATLPPDATSYTVKNLVTNNEYNFRIIAQNSEGKSAPLENIKPFKPTRAAEVPSVPRGSLQ
VTNLTDNSASLQWQAPEDSGGADLTHYLVDVSVDGGDWINLGKVDSYSTKFRCQDLKTDA
THVFRVSAVNKVGVGKALESQPVIPSKPPEAPGKPVGPLEAIDIQRTSITICWKPPLYDG
GSPLTGYIVERREAKRTLWSKVTTVKPDITTYQVQNLAEGNEYVFRVSAVNKEGVSKPLE
SDVFMARSPYNKPDAPVGPLNITNITEDSADLEWKPPQSDGGMPLTSYSIEMRDVRRTTW
LKVADVKPMVTTFTVPKLVLDNEYLFRVVAVNAEGVSPPLTSTTPISPVKKLGPPSAPEG
LRVKNVGKDYADLDWIPSRSDGGAKITAYRVYKSTVHPPIWEEVAKAKPYDTSYTVTNLK
EGTEYLFGVHLKMILA
NT seq 32811 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgtcaccgacatcgcttatgtctgttgacttgtcatttgatgagatggagttc
ttgagacctagtggtcgaccaccagtcgaggagaaagttcctttgccacctgtcttgcca
aaacctgtggccaagccccacctccaacacctgagttgtctgaggtggaggttccaacag
aggaatacaagaggcctagtgttgctgaggctaagaaacggtttgaccagccagaaggag
tatcaagcaccaccagctaaggtgcccaaacctgctgaagcaccagcacccaaaccaaca
gcacctcctgttcctgcttcaaagcagcagttctttatacccagggagaaatctccaagc
tatgagatccaagagacgggaccagtccaattaatcagctatgcatcagacacagaatgt
ggctacttaagacttatggatgagcaggatctagagagaccaccattctttgagaaaagg
cagctatcagagccaccagtcatgccagaaaaaaggaagccagaacaacttcctgtaatt
gctcctaaacctgttgcacctgtaaaggtacctccagcagtagcaccaaagccaaagcca
cccagcagaccagtggtaccagcacaggtacaacaacctgagccacagccaccattgctc
aaaccagaacctgtaactacaactttacagtttcagcccaaagagaaagaatacaggcat
gtggagcctcctaaatctaaaccagaaccagtcaaacatgtggtgacatttgcagcacct
ccaccaccttctccgcccagtgctcctgtggtcaaagctgcaccttcacccctaccccct
acagcccctaaacccactcaggtggcacccacacagcctaaagcaccacgtgttcgtgtg
cgtaaacaagcctcacatgaggctaaagtgcctatagtgctgaagcaggagcccacacca
tggtggcctgagcacattgatgtccccatggtggtggaagaagttgaaaagagagacagt
gaggaatttgagagtgcagtgcgggaatatatccgacgagaaggccaagcaccaccactt
gaagacttgtatgacaagaccaaaggcagaccacccaaattcaagactcagatcaaagat
ctcctaactctgaaagaaaacgagccagcacattttgagtgcaagcttgtacctataggt
gatcccacaatgaaagttgagtggtttaaagatggagaacctttgcatcatggtacacgg
tacaagcctgagtatgacttcggctttgtcagccttggcatacagtgggtaaatcctgaa
gactcaggtgtttacacttgccatgccaccaacaactatggtgaagactctacctctgct
actataaagtgcaaagcactgcgttctatcataatggacacacagcttcctggggagggt
gccacccgcctgcaggagatggaggaacactggcgcagccaaatgattctggaagaacgt
tatttagaggaaccacaaacacgatcaccaccattgtttgacctgaaacctgaaccagta
gaaactggtgaaggcgagcctgccaaattcctggtaaaggttggaggatttcctagacca
cgtgtcagctggtggatcaatggcagtcttattgtcagtggcactcgcttcaagctgacc
tatgatggcatgatgcatcacttagaaatacctcgcgtgagagagtatgacgctggacaa
atccgtgttgttgccaagaactcagaaggcgaggcagaatgcagcacttcccttcaagtc
ttgcccagagaagactggcgtgctcgtcttcgacaggcacctaaaggagaattagaaatt
gaactggaacggcgcagaaaaatagaactgcgtagtgttgaactggataaagcttttaag
aaacccaaggcaacagagtttgaattgcgccagttggaaagagctgcagaaacaaagatt
cgagttcagaaggatcaggaagtgatcacaactgaacgtcagtacatcagtgtccactca
cagctccgccacctggaacccagcatgcaggcagagcctgtatttgtcagacaggtaact
gtggaaaccattcgcccagaagaacctagcaaagtatcagaacagcagattacacttgag
cgtggccagcccccagtgttcactaaacctctgagacctgtcagggtgcctgagggaagt
ggtgtcacgcttgaagtgacctacactggaatcccaccacccattatatcctggtacaga
gacagttttgagattcaaccatcacgagacttccagattacaactacagaaaatagcagc
acacttcacatcccagaagtgttcttggaagactctggagttttctccgtcaaagcttac
aacaaatttggacaagttcaatgcaaagccaagttaactgttgttgaagcagaagagcca
cagcgtgaaatatcgccagaattccgcagcttgatgcgggacagtgtggtcacacagggt
gaaccggcaaccttcgactgtcaggtagctggaaacccatctcctaaagttcattggcag
aaggatggccgtcctcttggagaaagtcacaggtggaaattcatagatgaagacgagaat
catactttggtcatttatgaagttcggccagaagatgctggcctgtatgcatgtgtggcc
attaatagtgtggggaagtccacctgtactgccagactcactattgaaatacctatccag
cctccagagcagctgggacctactcctcagttggaatcaaaaattgaagccccatttgtg
atggaagaacctcggtctgtggaggtggaggaaggtgaacctgtcaaattcacctgcaga
attacaggtcgtccagctccagtagtaacctggtatcgcaacaatcagctggtgaaacca
tctaagtatttccagatgtcatctaccacagaaggtgtgcacatattatccataatggag
gcttttccagaagatactggcacctacaaatgtgttgctcgtaacaagtcaggggaagtg
gcttgcatcactgtccttaaggtccatggtctggaaagtgagccagagcccagccagccc
atggcaactgctcagccaccaagttttatcaagcctgtagccaacaccatggtacccgag
ggaacaccagctcgttttgaagctgttttctcaggataccccactcctgacatttcctgg
atccgtaatggcatccaaacactccacagctcaagagagtacaagattgagacgaaagac
agtctgacatctctgactatcttcaaggctatgcctgaggatacaggactcattacctgc
cgagcaaagaaccaggctggtacagctgaatgctctgcagaactttatgtgcagcaggta
cctgaatccacagaaactgctgcaccactagttgccagagatgaaatcaccgtcactttg
gagggtctggaagcaccagccacagaaactgtggccccagaaagatttgaggtcacagct
gtggagacaattgcagaaaaacctgttgagacggaggatgtttcacctaaacttgttacc
cgagaaacagcagaggctatttctcgtgaagaaacccaggaagaagcacctcttcctgag
tctcaagaggcagcaaaagaattcactactgcagagagatttgaaacactcatcacagaa
attgaagaggcatttgtggaggtctatcaacaagaagcatcagaggttgttgaagagaaa
gaattagaaaaaccttctgtatctggtgtatcactaatagaatcagtaccagaggaggaa
gaggagggctttgaagttgttggactgccccaagtggaagaatctcaggaggaggttgta
ctcaagggccatgctcccacattcctgcaaccattgcacaatgtggaggctgtggaagga
caaccagtatgttttgagaccacagttactggcttcccacagcctgaggtcacctggttc
cttgatggagagcccataaaggagtcacctgtatatcacattgttgcagatgctactggc
ttatgcattcttgaactgcatgaatcattcccagaagatgagggcgaatatgagtgccgt
gcatccaacaaatttggaactgccagcacaaaagcagatctctatatccaagagcgagca
gaagaaaaagatgagacgcttgtagttgaagaaatcctttctgaaaaagaaaaattagtc
actgcagaagaagaaaaagatgaggtctctgatgaagagaggaaagaagaaacactggaa
gaattgaaaccccatgtagctgaagtggaggagctacgctttgcaccagagattcgtatg
ggacttgaagacatttcaactttggatgggggccaggcacagttcactgccaaaattgta
ggtgttccacagccggaggtcacatggtacaaagaagaggatgtcattttcagttcagaa
gtttttgaaatcatccaggatgatgagaacaacttcattctcttcatccatgatgttatg
ccagaggatgcaggcagatacagcattgtggccaagaatgagatggggactgctacttca
tctgctcagctgacagttacagctgaggaagtaattgaagaagctcgaccagaagacata
tcaggacttgctccagaattcattgaaaagcctcgctttcagagtgtggaagaaggcact
accgtaattttcaaagcaattgttgaagccatccctcagcctgagattcactggactaaa
gacagtggtgagcttcctgaagatgagcgttaccaagtgatggttactcagggtatcaca
tctactgttcatcacatttccttgactgtcgctgatgttactccacaagatgctggaaca
taccgtgtaacagcatccaatcagcttggcgaagaaagtgtggcagtttctctcatagtg
aatcagctcactgaggtgaagaaagacttcagagaccagctgcagcgtgctgacctggag
ataccagagaaaccaatttctgtagacactgagcaggttgatttacgtggtcagcttaag
tctgaagtgaaaactagagtaggcatcatttatgaaagtcaacagattgacttccgaaat
cttttgcgaaagacagatcaaaaggcaaagaaatttgaagcagatcttaccacagctgag
acagtagagaccacagaagagctgctagaggaacagcctgagcaagctgctattgaggaa
gtcacaactgagattacactacctgaagaaacaaggccaaagtttcttgtgcctattcag
gacttaaccatcaaggaaggagaagtggcaaggtttgattgccaggtcaagtgtgaacct
gaggcaacactagtgtggtaccatctgcacaaacctatcaaatctgatgacatctacaaa
atagtccctggagaggatggctggagctcccttatcattgctgaggcattccctgaagac
tctggcatctacactgttcgtgcagtgaacagcataggagagaatgaatgttcagctgtt
cttacagttgaagaacttgtgtcagaggttagctcagttgaatctcacctagatgaagaa
caggagcaacctatacctgagacagtggctgaagaggcagccatcaagatccaggctgct
ttccgtggcttcatggcaagagaacatgtcaaaatcatgaaagaaacaaaactttcctta
gaacatgaagtcattatgcaggagatggccattactacagaagattccaccatctacaca
ccctccatggatgttgtacccgacacaactgctatcagcagtgaagaagttcagttcagt
ctcttggaggagactaagcctgaggaaaaaagtgaagttttcacagtggcagaagttgaa
gaagatcatattattgaagaagctgaaaaagaaatcatagaagctcctgaagaaatatca
cctgaaattaaggaggaagccatagaacccctagaggatattgtgactgttaaggcaaaa
gctgaaaaggacaaaatcccagaggaagtgatagttgaagataagatggtttttgaagtg
gaggaagaagaaaagccacttcttgagacagcttttgacattgtggtagaagagagcaag
aaaacagagatcactgaagtgactattacagatcagcagcctgaagtgaaagaatttgtg
ctttccacatcagatgaagatatgcttccagaggtcatagaagaacttgaagaacaggga
tcactcaaagaagagacagcagtagtcattacaaaaactactacacctgaaaaagcagtt
acagacctggaagcattaacaaaagttgaggaagttccttcagtgccatctgaaacaatt
gaagatatatctgtaagagctattccaaaaccagagacagttacttatgctgaagaagaa
acagttgaagtaccagtggctgcagctgccttgcctacagaagtatctacagatttcatt
ttatctgacacaaaggagcagctgccagagatctctgctgaaactgcagcagaggagact
ttggaagcatccacagctgaaataaaggaagaggaggtgacacttaccaaatcatttgat
gttgatcagctgacacaagagagtgttgaggaatctgcaggtatcagcacagaaggcata
ctacctgacatagttcatattgaagaaacagtcagagatcaagcacaagctgaaggtcct
attcctgtggaagtaaaagaagcagacactggagaggaggaagaggaaacagctttcatg
gcagaaatcgcaccacaagagacagccttacaagaagagaaactattggaggagacactt
gtctcttttgtcacaggtcaccagcctacagaaaccaaagaaatcattacaacagtacca
gaagaatctgttcaagaatttagagaagaggaagcagaagaatatgttacagaggagaga
gaagagattgaaaaagaaaccacattgatgaaagaagctgaaatttcagaggtcaaggaa
gagctgtcagtgatgtcaccagaacttgtatcagaactggaagaagaggtaatggaagat
atcacagttgaagaagagcaaagagaagaatctgctgcggtggtatttgatactgaggct
gctgaaataaaagaaagcattatgacattgcctctagaggataccaaagggattgaagaa
gttgttgaacaactgataagaccacaaggagaaatagctgaggaagaagctgttttcatt
gcagaaactgagactgccaagtctgaagaagatatggttgtggctccctcagatggtgtc
caagagatcaaagaagttacttcagaagcatttaaggaacaggaggaagtgtctgaaaca
gctattgctgtagaagcagaagcagaaactgcagaatcaaaagaagagatctctatgatg
ccagttgaagagatcagcagtcttcaagaggatgtcattatggaagtagtaatggatctt
acagaaggggcagaggaggctcaagttgccattgaagatatagcaactgtacagtcaaaa
gaacaaattacccaagaggaaatggaagagatgaaagaatttcaggaagaggttactcca
gatcttgtgacagtgcaaaaagaagaaatccagccactagctactgcaacagatgttgaa
acaactgtggttagagaagatgttaccataacatcattcgatgaaacccaagaactcaag
gatgagtttatttcagagactatcactgaaaaagaagaaatgaaagaagaagctttcact
gatgtagatcatgttacaccagccataacagaagaggaagttatcactttgatagaggca
gatgtcaaagaactcagcgaagagaagctcccagaatttggcacagaggagaaagaacat
cctaaagaaagtttaactgtagatgttgctcagaaaactgctgagactaaagaaagcata
gttacaacagtaaatgaagaaatccaggaacttgaagaagaggccaaacctcaggcaata
agtgaacttgaagaacagcctggtgaagctgtcacagaagttgtgtcctatgagattgcc
aaaagtgaagaagatattacagtaacaacagttgaatatgtaaaagaagtagactatgcc
atacaggaaactgcaactgaacaaaaggaggagactgaggaagccctaatttttgttgga
gcaacagaaacagctgatactgaagaaactattacctcagttccagtggaagaggtaaaa
gagcttgtggaagtgcttctgccagaaagtgttcctcaacaagaagtagaagttgaagaa
gttgtagcggtcagtttggatgttgaaactgctgagtctaaagaagaggtgaccatagag
tcaactgaatatatagaagaaattcaagaagttaccatgccagaaaaagtgacagaaatt
gaagaaactgagaaagttatcacaggagttgatgacatctatcctgcgatagcaaaagaa
gagacaacactatcacccactgaagatgtgggagaatttgaagaaaagattgcaacagag
attgttacagagctaaaagaggtagcagaagaacacatgcatgatattgtagatgctatg
ataacagagaccaaagaaggtgttacaggcactccctttgaatatgttggagttattgag
gaagaagctatcccagaaacagtaatagaacagaaagagcagctcccagaaactgtgtca
gtatatgaagagactgaaatcacaaaaatagaggaaatggcaacagaacaggtagaagaa
gtgatagacctttataaggatgaagaagaaattgtagaagaaaaagatactttaagggaa
actgtcactgctgtgaaagatattactccaactgagacaacaccgaaagtgaccacattg
cctgtagaagatgtggagcagctagaggaggagagagctgcagaggctcttgaagagcaa
gaggttgtggaacatatttccacttttgtggaggacatggttacatctgaaacaaaagaa
gatgcagccattggtgatgtagaaagtgtgactgaactcgaaagggaaatgtacccagag
actgtagaagaacaagaggaatcctttgctgaagcatctttaactgtagaggcaacacag
gtcactgaggttaaggaagaaactgtaccatcagagaaagaagggaagttggaaaaagtg
gcagcagatgaagttgtgcctgtggtagaagaatctttacaagaaacaccaacccttatg
gacattcctgtcagtgatgttacaccagagtacagaccagctgaagaggaaatcacagag
gaactagttggcacagaagaaaaacttgcagaagtgtctgaagaagatggctcgacagtc
atatctgtttctgaccaagttgtctttgaagctaaagatgttagtgagaaacaatcagaa
gatttaattgaaaagcagattgatgacataattagtgcttatccagatgaaacaacacaa
gaagatgttgtaacacaagttatgattgaaacaaaagatgtacttacagcttttgaaaca
cctgaatctactgtagaaggggagggagcatttgacctgactgaaagaccttcacctgat
gatgttgaggaagagatcacattacagacggttttagaacaagaaaagatagaggaagca
gaaattgatgtggtcattgaggatcatgttcctacagccaagcttatggagaggcctgaa
gaagatagagtggatgcaagagaagatttcttccttgaggttgaagaaaagccagttcca
tcagatactgaggcagaatatgttatttcagcagaagacacatcaacaaaagtagcagtc
tctatggaactcacagaagaagctgcaggagataaaacttttgcaattgaaatatctaaa
gaagaggtttcagttattgctgaggctgaagaggaaactaaagaagcaataatcacacac
attacagtagagcaagctccagaagacaccacttctgccacaatgtcaataagcatacct
tctgacactgaagctgaactcacaatcccagccgttatagcaagaggtgtagatgtgcca
ggagtttctgaggctatagacttaatccaggatgaacaggctcctgatgtggagggagag
atagagatcaccctgcctgcacagcctgtccaagaagaggttatatttgaagaggaagaa
aaaggacctgatgccacagattccttcaccctacaaaccactgttcctactgttgaagaa
gttgctgcagcaatcacactagaagccaaagttccaatcttagaagaggttgctgaagaa
atctctctctctcccaaagttccagagagaatggaagtagcagaggccatcacaatccac
acagaagaagctcctgaagctcctgtgacagaagaggtcgaggagtcagttacattcgaa
gtggaacatcctgcagataaagagaaggaagaggtttctgaagcagtgatactggaaacc
cctattcctgtaaaggaggaagtggctcagacagtcattctggagtctaaaccatcagca
gaagaagctgtttccgaagttgtagcagaagaaactcttctggcacctcactttgaccaa
accttgaacaaccaagagataactgagggagaaaatgtaacctttgaagtcaaggtcgca
ggaactccaaagccagaaataacatggttccgagatgatgtgaggatccagcctgatgaa
agatacaggatgtcagaagaagatgctatttacacatttactatcacaggtgccacacta
gatgatgatgctgaatatacctgcactgctaaaaatgcagcaggctctgcatccaccaca
gcagaactctttgtcaatgctgctggagaagccccaaccttcatcagcacccttaccgac
acaaaggcagacattggcacagatgtggtgttggagtgcaaagttaagggcacaccaaag
ccagagattgtctggctaagaagcaatgttgagctccttggtgacagataccagactgaa
aacttagaggaaacagtcagactgacaatcttaactgtcaacctgaagatcaagatgaat
atactgtcaaggctattaacccctctggtgttgcctcatgcacagcaagcctggctgtac
actttgaggctcccacatttacgtcctctggaagacttagcagtgagagtgaatgatact
gcccacctagtctgccaggtgaagggcataccccaaccagaagtcacatggctggtagac
aataagccactgactgtgagcccaaggttctccacaacctttgaaggggatgaagcaact
ttagagattgcagaggtcactttggaggacactgaggcgacttatacatgtcatgcccaa
aatatcgctggagaagcatctacaatagctcacctgcttgcccaagtcccagccaaaatt
ctatcagcaccatcctcaataagcactgtacctggagaaagtgtagtgataactatacac
tttgagggtctgccagctcctactcccacctgggcagtgaattcaataccactggtggaa
gatgagaggcatataatacaacacacagccacatcagtcaccctgatcatcccatcagct
gatgtgtcagattctgccactttcactttgacagtcaaaaatgagacaggccaggatgat
gtgtctgtggatgtcacagtcaaagcaccaacagaggaagtgatgccagaaaaaccagaa
ggacaagcaccagtatttgttctcaccattcaacctcagacaattgaagaaggtgaaacc
gccagttttacctgcaaggtgtttggaagtccagcaccagaagtgacatggacacagaat
gaccagccactaaaagatgaaggccgctacatgatttttgaggaagatggtgtccatcat
gttgaggtagatgagatcaccctcaaagatgctgggacatttacagctattgctacaaat
cctcttggccaagttacatgctctgctgagcttcaggtgaaagaaaaaccagttgaggct
gcaccccaaacagaagcacccagaattactatacctactaaggatatagaagcaactgtt
ggtgagaccatcaagttcttctgcaaagccacaggtgttccaaaaccagattttgtgtgg
ctgaaggatgaccaggaaataagtcccaccaatagcgaattcatcattgaatacactgag
aacgttgaaacaacattaactattccaaatgttcagccagagcatgatgccacctacact
tgtaaggctgtcaacccagcaggatcagatagttgcaaggcagagctgtttgtcaaagaa
tttattgaggaaaaaggattcccaccagaatttatcaaagctccacatcaggttgttgcc
agagaacatgactgtgcaaagttccttgtcagagtggtgggaatgcctgtacctacagtt
atctggaagcatgagtctcagactctggaggacaaagagctgtaccactttgagcagtat
gaggacacttactgctttgagatcaaagatgttgaaaaagaagatgctgggccatacata
tgtgtagctacaaactctgaaggagaagccacctgtgaaatttcacttattgtaaaagaa
ataccaagagaagagcgtttgtcagagtcaccacttgtcttaaaaacacaggaagaaaca
cgatcacctcagtttgttgaggtcttccaagacacatctgtaatggaggagaatgcgctg
cagctgacttgcagagtgactgggttaccgcgaccagaagtcacctggcttgtaaatggc
catgaactggtggttactcccaatgtcaagacttggtatgatgatgagactgtgaagctc
aagatcagttcaacaaagatggaccaggagggcacatacacatgtatagctacaaatcct
gctggttctgctgaatgttcagcttttgtaactgtggaaggaaaatcagaagcaccaaca
ttcactcgccatttgacagacagggagtgtcgtgaaggacgacctgtgaaatttgaatgt
gcagtcaaggggctacctaaaccacaagtctcctggttcttgaatgaacagccagtggag
tctggactccggttccatattgatgagcgtccaagttttgcagatatagttcacagtctt
agccttgaaagcacagaagttgaagatgcagggtttgtcaaggctgtggcaactaacaaa
gctggtaaagccacaactgaggcaaaacttctcattgaagaaaagaaagaaagtcccaaa
ttcctcaagaaactggataatctggaagttttggagacagagacagtcagactagaagtg
gttgtcagtggaaaaccaaagccacaagtaacatggctaaagggagataaagagctgaaa
gagagtgaagatgtgcattttgaggtttctggagaaacttacacgctggtcctggatcgc
tgtactatggactcagcaggtctctttacagctcgtgcacaaaacccagctggacagctt
tcatgtaatggccgcctgaaagtgatccctgttaaaaagccaaccttccaacgcaagctg
tcagacacccttgttcctgaaggtggtgtggccaaatttcagtgtcaggtgtctggggtg
ccaatgccagaaataacttggcttttgaatgatgaagagcttcagccaggtgaaaatatc
agatgtgagataaaccccaaggatggaacatgcaccttactcattactggcgccacaccg
accatgcaaggtgaaattaaggctgttgccaagaataatggaggagaagtcctttgttca
gccaagcttgatgtccgtggacgtgcaccaacatttgtggaagctccactaaaatgcaca
gttctggaaggacacacagctgagtttcgctgcatcattgatggagtgcctacacctaag
gtggagtggtctaaaggcaaatggatgaagttacaggatggaggacgaaacagagtattc
tttgatgagagtactggtgaacatgtcctgcagatggagggcattaagcccaaagatgct
ggtacatacactgtaacggctaccaatgagcatggcacagagcaggcaccagccacacta
atggttactgacaagcttgaagaagttgttgattggaaagctcagttgaagcacagggag
atccagcgagaggctaaagaagaggaaacagcttggaatattaaattaaagcatgtggaa
gttgaggagcagaagtctccctcacccgaagtgacacctaaacctccttctcctgagatt
gagcgtctggaataccatcctgcaccaaagcgagaacgcccagagcttgagtctgagcca
gaaccacatgagtttgaaataaagccaagggaacatgaagagcttgaagaatatctgcga
cccaaaccggtgccaccccaagctcttacagcagaagaagaacagaagacaggctacgtg
cgagctgttaaaactcgagaagaagaagagcttgaagaaaaagttcttattatacccaaa
gctaagtggcagtggattgttccccttgaagatctgagtgtgaaggagcgtgaagcagct
aagtttgattgtgagctatccattcccaatgtcaaagtagtatggcgggtgggtgagcag
gaaattgaacccagcccaaagtacgccatcacagaagatggcaagacacacacactactt
atcagcaagtgtcggcctaaagattctggtccagtgtcttgtgcctatggtgacattgtc
acagaagccaatctaactgttgaagaggtcccagcagatttcaccatgaaacttaaagac
acacaggcccaagagagtaccagtgcaacatttgtctgcctaaccaatgacgatgagttg
ccagtgcagtggcttgtaaatgacaagcctgtgacaccatctgaaaaatacaagattcaa
tcagatggctttcaacacacatttaccatctctgatctctctcctgatgataactgtgag
gtcacagttgtcattggtgataacagttctagtgctaagcttactgttgaagaaatcagt
gttgacttctcagtgccactgaaggacgttactgtcacagagggcaacacagcagaattt
cagtgtaccctcactatgcctgtggacaagagtaaggtccactggtttattaacaacaaa
gagattcaggaagatgagaagtatgaatttatttctgatggaacaatacagaagctgacc
attaaagattcaacaccagcagatgcaggagtagtgaccattaaaattggtgagaaagaa
tcgtcagccagcttcactgtagaagagattgctgttgacttcagcattccactcaaagat
cagacagtctacgagaaatcaattgtagagttcacatgtgaactgaccagagaggttgac
ggtgtgttgtggttccttgatgaggaagagcttaagcccagtgacactgttgaaatcata
aaagatggtccccatcataagcttattatccatgatgtcactcttgaagatgctggtgag
gtaaaagttaaggttggagacctgacatcatcagcagtcctcactgtccaggagctgcct
gtggagtttgttgtccctctcaatgatgtgagcgtgatggaaacggagacagcagaattt
gtctgtgagttgtcaaaggatatagagaaggtgcagtggttcttagatgatgttgagttg
aatgagagtgaccgcatagagtttgtaaaagagggtctcaggcacaagctgcttgtccgc
aactcttctattgatgatgagggcctcattacagtacaggcaggagacaaaaaatctacg
gcatccctgttcatcagagatcttcctcctgagtttattagaccacttcagaaccaggaa
gtaaatgagggtgacagtgtcatatttgagtgtgaactgaacatggacaatacgacagcc
aaatggttccatgatggtcatgaaatcagtgatgataggcactataaaattgtccgtgaa
gggagagttcatcgacttatcatcatagacgccatcttacctgatgctggagacattact
gccaaagtggaggacaaatctacaacttccactctaacagtgcatgaagttcctgtcgag
ttcatggcagaactcaaggaaatccacacagaagagcacaagattgcctatttccaatgt
gaggtcaacaaagatgatgtcactgtcacgtggatgaaggacaatgaagtcattactccc
agcaacaagcacattatggaacatgatgagcgtattcacacgcttgttatcaaagatgta
gattccaatgatgttgctgagtatgcagtagttgtaggggacagaaagagttcagcccgc
ctccatctagatgagcttcccctcaatctcagtctcagcgtgaagcgatttacagtggac
tcggagtcccttgctgtgttcatatgtaatgtttccaaagttgacttgcgtgtttcgtgg
taccgaggcgacagaaagctacaccctagcttcaaatatgagattctcaatgaaggctgc
atgcataagcttgttgtgcatagattgaacattgaggattatgatgactacattgtggtc
attggcagtcgccgtttgactggaatcacactgaaggaagaagcaccactggaattcact
attccattgtcagaacaaacctgcaaagaaggagaaacagtcacctttttgtgtgaagtc
actgaaaccaatgttcctgccaagtggttcaagaatggaatggaacttcagccatcagag
accatgtccatggagatggatggcaaagtgcatcgtcttgtgctgcgtgacacccatatg
gaggatactgctgaatacacagttatcatcaaagacaaagatagcagtgccaagctcact
gtggaagaaattgctgctgacttcacattgaagcttaacgacactgaagcacaggagaaa
gacacagtgtccttgtcttgtgaggtcagcaaaccagatgtcatggtcgactggcttctt
aatcaggagattcttaaacctagcgacaaatacaatatggagcaggatgggacaacacac
acacttaccatccaggaagtttcacctgatgattctggcacatacactgctcgctgtggt
ggcaatgaaacctctgcatccctgacaatcaaagaaactccactggaaatcatcgttcct
ctgaaaaagacagagtgtacagaaggggattccgtcaccttgacatgtgaggttaacatg
ccagacaaaccagcacgttggttcaaggataaaacagaaatctttccaacagaagagtgc
cagctcaaagtggagggaacagtacatactctgaccataccaagggccactcttgaggat
gaggcagaatacaccatctgtattggtgataagacctccacagcacttttgcttgtggaa
gaaagtcctgttcacattacacggccactgtgcgacactgagtgccttgagggagagact
gtgagctttgtgtgtgaggtctcgaaacctggtgtacctgctatgtggctgaaggatggt
gtacccatcacagaagatgatggctttgagtttatcacagatggctgtacacacatacta
aaaatacctgaggccacacctgaccatgatgctgtttacaccatcaagatcaatggcagc
aagtccattgccaagctttttgttgaagaggagacccctgacttcagagccaggctgaaa
gatgtatcagggcgtgaaggtgacgacgttgaactagagtgcctgctgaccaaagcaaac
atcccagttcgctggctgaaaaaccgcaaacctcttactccatcagaccgcatcaagatt
gtgtgtgatcgctaccgccacatgctgcgcataatggaaacaattccagaagatgagggt
gaatacacagttatcttgggtgatgacaaagaatcttcagccaccctcacaatctatgaa
atacctacccagttcacaaaagatctgcgggaccaggaggtacttgaacaggagactatt
gaacttgaatgtgagctctctaaaaaaggaaaacctgtcaagtggctgaaggatggaatg
gaaataattcctggtggccgaattgagattgtatatgacagattcctgcatcagctgatt
attgaagatgccactttggaagatatggggcgctattcttgtgtttgtggtgatgtgtcc
acatctgctaatgtgaaagttgaagagcttcctgtggaaattctgaaacccctccatgat
gtgaccgctacagaaggccagcccattacacttgagtgtgaagtttccaaacccaacgtg
cctgctcgttggcttaaagatgggaaagttcttgagccatcagagcggtatcaccttgtt
gtggatggtaccatacacaaactggagattcctgcatccgaacttgatgatgaagctgat
tacactattgaagtgagagacaagagcagcaaagccatggtgctggttgaagaaattgct
ttggagatcctcagccctctgtctgatcagaaggtggaagaaaagcagccattcacattc
acatgtcaagtgtcaaagcctaatgctaaggctcgatggctcaaggatggccaagaaatt
acaccagcagatgatgttgagatttctcatgatggacagattcacactctcacaaagaaa
gatgctagtctagatgacaaaggaaaatatactgttgtgattgaaaataaatctagctca
gcaatgctcagtgttacagaactaccaacaacattcgtgcgacctcttgccaacatcact
gtaactgaacaccagaaacttgccctggagtgtgaagtcagtcgccctgacaaaccagca
cagtggttcaaagatgatgttcctgtggcagcttctgctcgaatccgtctgacgtctgaa
ggtggagtgcatcgtctagagactgactctgcagagttagacgatgaagctgtgtacaga
gtagttgtcaatggtgcagaaagttcagctgaagtctttattgaagaactacctaccacc
attgtgcgcccactggccaacatcactgttactgaacaccagaaacttgccctggagtgc
gaagtcagtcgccctgacaaaccagcacagtggttcaaagatgatgttcctgtgacagct
tctgctcgaatccgtctgacgtctgaagatggagtgcatcgtctagagattgactctgca
gagttagacgatgaagctgtgtacagagtagttgtcagtggtgcagaaagttcagctgaa
gtctttattgaagaactacctaccaccattgtgcgcccactggccaacatcactgttact
gaacaccagaaacttgccctggagtgcgaagtcagtcgccctgacaaaccagcacagtgg
ttcaaagatgatagtcctgtggcagcttctgctcgaatccgtctgacgtctgaaggtgga
gtgcatcgtctagagattgactctacagagttagacgatgaagctgtgtacagagtagtt
gtcaatggtgcagaaagctctgctgaagtctttattgaagagctacctaccaccattgtg
cgcccactggctaacatcactgtaactgaacaccagaaacttgccctggagtgcgaagtc
agtcgccctgacaaaccagcacagtggttcaaagatgatgttcctgtgacagcttctgct
caaatccgtttgacatctgaaggtggtgtgcatcgtctagagattgactctgcagagtta
gacgatgaagctgtatacagaatagttgtcaatggtgcagaaagctctgctgaagtcttg
gtgaaagaactaccgactacatttgtacgaccattggccaacatcactgtgatagaacac
caaaaactggtcttggaatgtgaggttagtcgccctgacaagccagcgcagtggttcaaa
gatgatgttcctgtgacagcttctgctcgcatccgcctgacttctgaaggtggagtgcac
agactgattattgactgcgtggagctggatgatgaggcggtttacaaagttgtcattggt
ggcaatgaaagtacagctgaagtcttggtagaagaagaaccagtggaattcaccaggaag
cttagggacattgaagttacagaaaaagaaacagctgtctttaaatgtgaaatgagcaag
cctgatttggaagccatttggttgcacaatggccagtcagtctcagtggaagatggattt
gatattaagatagagaaaactatccattctctggtcctagaggatgtatcagtggaagat
gctggcatctacagcattaaagttggagacaaaatcagtgaaggaagattatcagtgaaa
gaactgcctgttgagttcaccaagccacttaaagatctggaagtgatagaaaaaatgcct
ctggtcctgagctgtgaagtaaacaaaccagacagacctgcaaaatggcaacgcaatggt
caggatgtgacacctactgaccatatccagatcactgctgatggctgcacccacactctt
tcaatctcttctgctaatctggaggatgaggctgtgtacaaatgcattgtgggtgacaaa
aagtcatcaggacgagtcacagtaaaagaagagccactgaccatactgaagccactgatc
gatcaaacattaatggagtaccagcctctggtgctagaatgtgtggtgtccaagccaaat
cgttctgccacatggtacaaagacggatctaaactgacatcatctgaccacctgactatc
atttccgaagataagaagcatatactcaccattgacagactagcaatggatgatgaagct
gaatattccatcaaggtagaagatttgacatccaagtgtactgtccttgttgaagaagaa
gacctggagtttgttcgcaagcttgaggacattgatgtaaaagaaattcctggcacagca
ctgtttgagtgcgaagtaaacaaagtcagtacagtggcagagtggttcttcaacaatcag
cctttgacggctagtgacaagtatgagatggagagcaaaggcgttattcatcgccttaag
gtcaaggatgtggatggcagagatgaaggtgactacaaagttgctgtcagaggcaaaaca
tctgaagctggactcttcgtggaagtgccacccaagattttcttggacaagaaatacgat
gagactatctacctgtatgctggtcaatccacagcctttgaggtgcccttcactggtaat
cctcagccaatagttacttggacttttaatgagggtgatctccctgataagattcgcatg
gagacagaaactatatacaacatgaccacaatacgtatgagccatgtgaagcgtacagat
actggaagctacacagtaacgctcagcaatgacaatggaaaagctgttattagcatcaaa
ctggttgtacttgataagccttctgcaccacagaatgtcactgtaacagacatcactgct
gagacagctactgtcacctgggagaccccagaagatgatggtggaaagcctatcacacag
tatgtcattgagaaacgtgaggccaacaggcaatcttggaagaggattggtgacacacca
tcactgcagttgcctgtatcagacctagtagagaatgcccagtacatcttccgtgtattt
gcacagaatgatgttggtctcagtgaaccaacagagtctgaaattatcacagcaaagaat
ccattcacggtacctgatgcaccagacgcacctactgtgacagatgtcatgcacgactca
gctgttgtgtcctggcagcagccagctaatgatggtgggtctccagtgactggatacacc
attgagcgtcaatcatcttacagccctcgctgggtgatagtgaacaagactcctgtgcaa
aacctgagcttgaaggtagatgatctaatagaagacaatgtctaccagttccgtgtcatt
gcacgtaataaggctggtcccagtgagccaagcaaaccctctgacagtattgtggctaaa
gacccttggaatgttcctggcaagccaggcacaccagatatcactggcacagaccagagc
tctgtggctctgaagtggacaccacctgaaacagatggaggcagtcctatcacaaactat
gtggttcagtaccgacctattagcgctacacagtggattcaagctaatgaagccttcatt
gttcctgatacaacttttagtgtcacaggcctgagggagaatgctgagtatgtgttccgt
gtggcagctgagaatcgtgcaggtgctggtgaaccatcatctccaacaaaacctgtcaag
gttgtcaaaccacttgttggcacatcacctatgctgctagaaccactgcaggacaccaca
gttgttgcacctggtgatgccattcttgaatgtgacatagatgtcggagagcctgaggca
gaaattaaatggttccgtggcaagaaagaagtaaagaagagccccaagtatgaaatgagc
tacgaggatgaagtggcatctcttgtaattcataaaactgagcctgacgatgcagacgtg
tatcgctgtgaggcttccaatccacttgggcgtgttcagacagaaggcctgctaacagtg
cacactcacccagtcctggagtatgacaacagactcaagagtgcacagacaatccgggct
ggctccactctagtgctaaaggtcaacaccactggaatcccatccccatcagtatcttgg
atgctcgacaatgagccactacaaaaatcagatcgaatcagcattgagaccacagatgaa
tacagcaaattgactctcaaaaatgctcttcttgatgactctggggtttatactatctgt
gctgaaaatgttgttggcagggctgaggctgactttgatgtcaaagtgaaagataaacct
ggcaagcctaacaatctgcatgttattgaagtcctaaaagatcagatagccattgcttgg
gaacctccaacctccacaggcaattgtcccctgaagggctatgtgattgagaaacgagat
gccaaacgcaatacatggactccagttcagcgtgttgacaacataactgtgatgtattca
gtgcagaaacttctggaaggcaatgaatacttcttccgtgtggcagctgagaatgagata
ggagtaggagaagctgctgagctctttgatggcatagtgcccaagagtccctatgatgtt
cctgatgcacctaagaagctgcagcctagtgagatcacccattcatcagtcaccctgaca
tgggagccaccagagagtgatggaggatctgtcatcacaggttacgctgtagagaggaag
tcaccggcaagcccccgatggacaagagtaaacaagagtcctatcagagatacagtgtac
acagtgatggatcttgtagaaggcaatgaatatgagttcagggtcttggcagagaatgct
gcgggcttcagcaaaccttcagaacctaccctgcccataaaggctgttgatccatacaat
aaacctgatgctcctggcagaccagaggcaatagacatcaataaggagtctgtcacccta
aaatggcttccaccagacagtgatggtggcagtgctatcttcaactatgttgtggaaatg
agagtgagtggttcctcaagatggcttcctgcaagccagaacataaaggtgccagatagc
agctttattgtcagacagttgaccaagggaacagaatatgagttccgagtcagtgcagaa
aacaaagctggaattggacccccatctccaccttccttgccagtcacagctcgcaaacct
ctcacgggtgaagcccctactgtgctggaaggtttacctgacctggctgtgatggaggga
gatactacagtatttgaatgcaagatcagtggtgagcctgtaccaagcatcaaatggctg
aaggaacagagggaaatagtggaggacaaacgccatagcatgctgtatgacgagtgtgtt
gcctcccttactgtgagagacacaacacagaaggatgctggaacctatacctgtgaagct
agcaatgatttaggcacagtcaccacatctggtgttctagagatacaagccgcacctact
cttgaatttgacaacaaattccgtgaccttataagtctacacataggcgccaccctgaaa
attccagtcaaggtgggaggtatcccaacacctcagattacctgggctaaagaagagaac
ccactgcgtccagggggacgcatcgccatcagcgtgcaagacgacagcaccactctgacc
gtgaagaaagtaaccaaggaagatgatggcttaatcacccttactgcagaaaaccaagtg
ggtgaaaccaaggccaaatttgatgtggaggtgctagatgtacctgctgcaccagaaggc
ccgatggaagtgacagatattacagacacttcagttacattgcactggaaacctcctaaa
gatgatgggggcattgacattagaagctacatcatagagcgccgtgacaccaagcgccct
gtctggagcagaatgggcagtgttgatggtgtgacccttgatttcaaggccacagggttg
caggaagggacagaatatctgttccgtgtgtttgctgaaaatgaagtaggactttctgag
cctcttgaatctaccacaaaagtgatccccaagagtccatttgataaacctgatgctccc
gaaggtcccttgcaggcatcagatattaaagaagacagtgttactctcacttggaaacca
ccgaagtcagatggtggatctctagtcactggctacattgttgagaaacgagatgctcga
aagacaacgtggtccaaggtagcttctacagattcacaaatgctcacctgtaaagcaagc
aagctactttcagggacaccatacatattccgtgttatggctataaacaaggagggaatg
agcttaccacttgaatctgaagaagttgtcccacagaaaccaccagaaactccaggaaaa
cctgttggccccattaagtttagtcaagtattgtctgactcggtgacccttgcctggaca
ccaccgaagaaagatggcggttcacctgttgttgcctataccattgaactgacggatgat
gctgggaaaaactggaagcacattggtactgtcgaggctgttcacaccatctacacagcc
gaaggtctttcagaagggcaggattacaaattcagagtttgcgctgtgaacagcgtaggg
ccaagtgagcctcttgtgtcagacagcatcagaccagaaaggaaaattggtaaacctgca
aaaccagagggacctttagaagctgttgacattcagcgaaactctgtcaccttgaagtgg
aaaccacccaaagaagatggtggctcaccacttactggctatgttatagaaaaacaagat
gtcaagtatggcagctggtctaaagtgggtaaggtggagcccactgttactgaattttgt
gctatagacctccaggaaaaatccaactatctcttcagagtgatggcagtcaacaaggct
ggacagagtgagccactggaaatggataagcctgtcactgccaagagtccttttgatgta
cctggtaagcctaaaggaccacttgagatcagtaatgtgaccgacaagtctgctgacctg
aagtggaatccaccagaaagtgatggaggcagtccactgacagcttacatcattgaggtg
cgtccagactccagatccacatggacaaaggcaggaagtgtggatggcaatagtacaacc
ttcactgtacctgacctcaaagagggaacagaatatcacttccgggtcatggctgtcaac
gcagagggtcagagtgcaccactggaggctgtagacacagctaaaccagccaagaagaaa
gttccacctggtcctcccagagatctgcgagctgcacgtgttggtccagactatgtcact
ctagaatggaaaccaccagcagaagatggaggtgccaaggtgacccaataccgtgtggag
aagtgtgaggaaaccagtgaggagtgggtgaaggtggaggatgtcaaatcccttgacaca
gcctacaaagtgacagatctcaaggaaggcgtggggtactacttctcagtgtctgcaaag
aatgaggttggctttggtgaaccatgtgagacagaagctgccatcacacccaagaaacct
gaaggtcccccaggcccaccaactgctcctctcactgcagaggacatagacaagacatca
gtgactttgtcatggaaacctccaacagaagatggaggatctcctctcacaggctacatt
ttagaacgccgagaatccactcgcaccacctggaccaaactggaccgcataggaccagac
acattgttatataaagcactgaacctgatagaaggcaatgagtactacttccgtgtttca
gctgagaacaaacatggagtcagctcaccactggagacagactctgctgtaaagcccaag
agtccatatgatgtacctagcaagcctagaggaccactggagatcagtaatgtaacagac
aagtctgctgacctgaagtggaatccaccagaaagtgatggaggcagtccactgacagct
tacatcattgaggtgcgtccagactccagatccacatggacaaaggcaggaagtgtggat
ggcagtagtaccaccttcactgtacctgacctcaaagagggaacagaatatcgcttccgg
gtcatggctgtcaacgcagagggtcagagtgctcctctggaggctgtagacacagctaaa
ccagccaagaagaaagttccacctggtcctcccagagatctgcgagctgcacgtgttggt
ccagactatgtcactctagaatggaaaccaccagcagaagatggaggtgccaaggtgacc
cattaccgtgtggagaagtgtgaggaaaccagtgaggagtgggtgaaggtggaggatgtc
aaatcccttgacacagcctacaaagtgacagatctcaaggaaggcgtggggtactacttc
tcagtgtctgcaaagaacgaggttggctttggtgaagcttgtgaaacagcagctgccatc
acacccaagaaacctgaaggtcccccaggcccaccaactgctccactcaatgcagaggac
atggacaagacatcagtgactttgtcctggaaacctccaacagaagatggaggatctcct
ctcacaggctacattttagaacgccgagaatccactcgcaccacctggaccaaactggac
cgcataggaccagacacactgtcatacaaagcactgaacctgatagaaggcaatgaatac
ttcttccgtgtttcagctgagaacaaacatggagtcagctcaccactggagacagactct
gctgtaaagcccaagagtccatatgatgtacctagcaagcctagaggaccactggagatc
agtaatgtaacagacaagtctgctgacctgaagtggaatccaccagaaagtgatggaggc
agtccactgacagcttacatcattgaggtgcgtccagactccagatccacatggacaaag
gcaggaagtgtggatggcagtagtaccaccttcactgtacctgacctcaaagagggaaca
gaatatcacttccgggtcatggctgtcaacgcagagggtcagagtgctccactggaggct
gtcgacacagctaaaccagcaaagaagaaagttccacctggtcctcccagagatctgcga
gcagcacgtgttggtccagactatgtcactctagaatggaaaccaccagcagaagatgga
ggtgccaaggtgacccattaccgtgtggagaagtgtgaggaaaccagtgaggagtgggtg
aaggtggaggatgtcaaatcccttgacacagcctacaaagtgacagatctcaaggaaggc
gtggggtactacttctcagtgtctgcaaagaacgaggttggctttggtgaagcatgtgaa
acagcagctgctattacacccaagaaacctgaaggtcccccaggcccaccaactgctcca
ctcactgcagatgacatagacaagacatcagtgactttgtcatggaaacctccaacagaa
gatggaggatctcctctcacaggctacattttagaacgccgagaatccactcgcaccacc
tggaccaaactggaccgcataggaccagacacattgttatataaagcactgaacctgata
gaaggcaatgaatacttcttccgtgtttcagctgagaacaaacatggagtcagctcacca
ctggagacagactctgctgtaaagcccaagagtccatttaatgcacctagcaagcctaga
ggaccactggagatcagtaatgtaacagacaagtctgctgatctgaagtggaatccacca
gaaagtgatggaggcagtccactgacagcttacatcattgaggtgcgtccagactccaga
tccacatggacaaaggcaggaagtgtggatggcagtagtaccaccttcactgtacctgac
ctcaaagagggaacagaatatcacttccgggtcatggctgtcaacgcagagggtcagagt
gcaccactggaggctgtagacacagctaaaccagccagaaagatatcactcccaggccct
ccagaaggtgtgcatgctgctcgtgtgggtcctgactatgtcactctagaatggatgcct
ccttcagatgatggagggtcaaagataacagcttatcgtattgaaaaatgtgaggagaca
agtgaagagtgggtgaaagtcgaggacatcaagtctttggacacagcctacaaagtgact
ggtcttaaggaaggtgttgggtatttcttctcagtgtctgccaagaaccaggttggcttt
ggtgaaccatgtgaaacagaggcagttatcaaacctaagaaacctgaagaacgaccaggg
ccacccacaggaccacttcttgtctctgacattgacttaacttcagctactttgacctgg
cagcctccacaagatgatggtggagcacccatcacagcttacatagtggagcgcagggag
tcagggcgcagcaaatggaccacattagaccacctagatgctgatactctcactctgaag
gccatcaatcttattgacagctgcgattattatttccgtgtcatggctcagaacagaatt
ggtcttagtgaacctttggagaccgaaaaatctgtcaaacctcagagtcctttcacaaag
ccatccaaacctgttggaccacttgagatcagcaatgtgaccgacaagtctgctgacctg
aaatggaatccaccagaaagtgatggaggcagtccactgacagcttacatcattgaggtg
cgtccagactccagatccacatggacaaaggcaggaagtgtagatggcaacagtactgct
ttcactgtacctgatcttcaagcagatacagaataccacttccgagtcatagcagtcaat
gcagagggtcagagttcacctcttgaagccaaagacacagctaagcctgtaaagaagata
gtacccccaggtccaccttcaagtctccgtgtcagcaagattggaccagattttgttacc
cttgattggaaggcaccattggaagatggtggatccagaatttctggctatcgcctggaa
atatgtgatgaaagctcagatcagtgggtcaagcttgctgacctcaaggcatttgataca
aattttaaggtgacaaacctgaaagacactgtcagctacctatttgctgtgtctgcccag
aatgctgctggctatggtgagccatgcgagacagagacagcagtcagccccaagaaacct
gaaggtccgccatccaaaccagttgggccactcaaagcaaaagaaattgaacgcacttcc
attgcactcgagtggcagccaccaaccagtgatggaggttctcctatcgcaggctacatt
ttggaaaaacgtgactcaggccgaccaacctggactcgtgtggaaaaacttatgccaaac
aagacatcatacaaggttcagaatctgctcgagggctcggagtactacttccgagtcagt
gcagaaaacaaacatggaaccagtgagcctctagaaacagaggtaacagtcaagcccaag
agtccatttgataaaccatccaaaccgacaggccctatcagattctctgatgtcacaaag
gattccatcactctttcatggcagcctcctgatagtgatggcggcctacccattaacaag
tacaatattgagtaccgagacacacgcaggacagcttgggtgaaagctggctcagtttcc
aaggagaacactagcttcacttgtgcagacctgattgagggtaatgagtatatcttccgt
gtcactgctctcaacgatgagggtgaaagtccaccccttgagtcaaaggaaaccgtgaaa
cctcagagggaaataacaaccccaagcagtccagcaaacatctccatcaaggacacagga
aaggatttcatcactgtagaatggtcagcacccaaagacaatggaggctcaaaagtaaca
ggctacacagtcatgtaccgagatgaggattcagatgactggactcaagcaggaagtgta
ggatctctggagacaagcttcacagtcaaagatctgtctttggacaagaagtactatttt
gctgtggcaggtgaaaacaagaagggcttgggagatcgaatagagacaacatctccggca
tcaccaaagaaaccactgcaaaaaccatcaccaccagaaggtcccattaagtttacagac
atccagcgaacatctgttaccttcacttggggcccatcaccctatgatggaggcacacca
gtcacaaactacattctggaaatgagagagacttggaagataacctggtctcctgtgacc
atagtaaaaccagacatcacttcctattgtgtccagaatctgaaagaaggaacagagtat
ttcttccgtgttattgctgagaatgctgttggcaaatcagagccactggaatctgatggc
gttgtgcccaaaaacccctatgcacctccaagtatgccagaaggacccttggaagcatgt
gatatcacagctaacagtttgacattgaactggaaaccaccattaactgatggaggtcag
cctcttacaggctatctccttgagagccgtgatgtccgtcgtccagtgtggtctccagtt
gccacacttccacctgatgccaccagctacacagtcaagaatctggtgaccaacaatgag
tataacttccgcataattgcccagaactcagaaggcaagagtgctccactggaaaacatc
aaacctttcaaaccaactcgtgctgcagaagtaccttcagtccctcgtggttccctgcaa
gtgacaaacttaacagacaactcagcatcactgcagtggcaggctccagaggacagtggt
ggagcagatctaacccattacttggttgatgtgagcgttgatggtggtgactggataaat
ctgggtaaagtggacagctactccacaaagttccgttgccaggacctcaagactgatgcc
actcatgtcttcagagtatctgcagttaacaaggtgggggtgggcaaggctttggagtct
cagcctgtcatcccttcaaagccaccagaggcaccaggaaaaccagttggtcctttggaa
gcaatagatattcagaggacatcgatcacaatctgctggaagcctcctttgtatgatgga
ggctcccctctgacaggctatattgtggaacgacgtgaggccaaacgtacgttgtggagt
aaggtgacaactgtcaagccagacatcacaacttatcaggtccagaatctggccgaaggc
aatgagtatgtcttccgtgtgtctgctgtgaacaaagagggtgtcagcaaaccattagaa
tcagatgtcttcatggcaagaagcccatataataaaccagatgctcctgttgggcctcta
aacattaccaacatcacagaagactctgctgatctggaatggaagcctccacagtctgat
ggtggtatgcctctcacgtcatacagcattgagatgcgagatgttcgacggaccacttgg
ctaaaggttgctgatgttaagccaatggtgaccacattcacagtcccaaaacttgttctg
gataatgaatatctcttccgtgtggttgctgtcaatgctgaaggagtaagcccaccactg
acttcaaccactcctatatcgccagtcaaaaaactaggaccacccagtgcccctgagggc
ttacgtgtgaagaatgtaggaaaggactatgctgatctggactggattccctcaaggtca
gatggtggtgcaaagatcacagcttaccgtgtctacaagtcaactgttcatccacctatt
tgggaagaagttgcaaaggcaaagccttatgacacatcctacacagtgacaaatctgaaa
gaaggaacagagtacctatttggggtgcatctgaaaatgatattggcctga

DBGET integrated database retrieval system