KEGG   Pomacea canaliculata (golden apple snail): 112570995Help
Entry
112570995         CDS       T05881                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcan01009]
    112570995
Enzymes [BR:pcan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112570995
    3.1.3.48  protein-tyrosine-phosphatase
     112570995
Protein phosphatases and associated proteins [BR:pcan01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    112570995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase OST_P2
Motif
Other DBs
NCBI-GeneID: 112570995
NCBI-ProteinID: XP_025105556
AA seq 422 aa AA seqDB search
MPESGDVDILTPPRVHLASRRRFDLKLDLTTTPSGRERGEKKLRLELLTAPILDIPNKIS
DNTINTANIANTTTSTGCSSCLNKQTDASPDELVEVSSTPPASVRTIAAGELAAKLRKAR
TVLVIDCRSFLDYNLHHVQGAVNVSCTDRFNRRRLQQGKVGVMDLLAAHGKDHFRRKHAR
DIVLYDGRSNGQDQLDGESALHTVLTTLLREGRQPAVLQGGMKQFEAEYPDLCWSARRQD
VPDRPLCSPTNDTMEPEIETATASQVLPFLYLGNERDAAELERLRRHNITYVLNVTAHVP
QYWHAHGIRYKRIPASDSAQQNLKQYFEEAIEYIDDARQNGACVLIHCHAGVSRSATITI
AYILKHTKMAMSDAYKYVKGKRSIICPNFNFMGQLLEFEQDLNQGNSPRILNPRLQGLES
TV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccggaatcgggcgacgttgacatcctgaccccacctagagtgcacctggcttcccga
cgaaggttcgacctcaagctggacctgactaccacacccagtggcagggaacgtggtgag
aagaagctccgactggagctgctgacagctcccatactggacattcccaacaagatctcc
gacaacactatcaacactgccaacatcgccaacaccaccacctccacgggctgcagcagc
tgcctgaacaaacagaccgacgccagccccgatgagttggtggaggtgtccagtacccct
ccggcctctgtgaggacaattgccgcgggcgagttggcagccaagttgaggaaggcccgg
accgtgctggtcattgactgtcgatccttcctggactacaacctgcatcacgtgcaaggc
gcggtcaacgtcagctgcactgaccgttttaaccgccggcgattgcagcagggcaaagtg
ggtgtcatggacctgctggccgcgcacggcaaggaccacttccggcgcaagcatgcgcgt
gacatcgtcttgtacgatggccggagcaatggtcaagaccagctggacggggagagcgcc
ctacacaccgttctcacaacactgctcagagagggtcggcagccagcggtattacaaggg
ggcatgaagcagttcgaggctgagtatccggacttgtgttggagcgctcggcggcaggac
gttcccgatcggcctttgtgtagtcctaccaatgacaccatggagccagagatcgagaca
gccaccgcctcgcaggtccttccattcctttacctcggtaacgaacgtgacgccgccgaa
ctggagaggttacgacgtcacaacattacctacgtgttaaacgtcacagctcacgtgccg
cagtactggcatgcgcacggcatccgctacaaacgcatcccagcttcggacagtgcccag
cagaatctcaaacagtatttcgaggaagccatcgagtatatagatgatgcccggcagaac
ggcgcctgcgtgctgattcactgccatgcgggtgtgtctcgctcggccaccatcaccatc
gcctacatcctcaagcacaccaagatggccatgagcgacgcctacaaatacgtcaaaggc
aagcgctccatcatctgccccaacttcaacttcatgggccagctgctggaattcgagcag
gacctcaaccagggcaactcgccccgcatcctcaatcctcgtctgcagggcctcgagtcc
accgtgtga

DBGET integrated database retrieval system