KEGG   Pomacea canaliculata (golden apple snail): 112571003Help
Entry
112571003         CDS       T05881                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit-like
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcan04040]
    112571003
Ion channels [BR:pcan04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112571003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin L_HMGIC_fpl Clc-like Amastin
Motif
Other DBs
NCBI-GeneID: 112571003
NCBI-ProteinID: XP_025105568
AA seq 301 aa AA seqDB search
MWNPTGFEPHRAGGVAASEEEEAAATPPRPGRRRREDARESQMVAPSGCSLYTLTGLSLL
FGAVTVVTLALAVATDCWLFMSEPYQLTAQEMRELNITEPIQTDIVVHVRTGLWRVCTTN
LMNGTFPDQCIAIDYQQKGSGRLEGAPTCMTIVGSIRVSSPLMVTGLVLTLTAVVMSIVG
SVRHSGKTVIAAILYVLTGLCIAVGIILYISAINDEVGYRTQTKGKSRDFQYYYGWSFFL
AAGDFVLAEVAAVLNVTLYLRHNSRVSDMVRIIPGLEDKLQTSSFRLEADALDTRGRGDV
W
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatcctacaggttttgagccgcaccgcgcggggggagtggcagcatcagaggag
gaggaagcggcagcgacacctccccgccccggccgcagacgacgagaggatgcgagagag
tcgcagatggtggcgccctcaggctgctccctgtacacactcaccggcctgtcgctgctg
ttcggcgccgttaccgtggtgaccctggctctggccgtggccaccgactgctggctcttc
atgtccgagccctaccagctaacagcccaggagatgcgcgagctcaacatcaccgagccc
atccagacggacatcgtggtgcacgtgcggacggggctgtggcgcgtgtgcaccaccaac
cttatgaacgggacgttcccggaccagtgtatcgccatcgactaccagcagaagggatct
gggaggctggagggcgcgcccacgtgcatgacaatagtaggctccattcgggtgtcgtct
cccctgatggtgaccggccttgtcctcactctaacagcagtggtcatgagcattgtgggc
agcgtccggcacagcggcaagactgtcatagctgccattctctacgtactcactggtctc
tgcatcgccgttggcatcattctctacatttctgccatcaacgatgaggtcgggtaccgc
acgcagaccaagggcaagtcacgtgacttccagtactactacggttggtccttctttctg
gcggccggcgacttcgtgctggcggaggtggcagccgtgctgaacgtcaccctgtaccta
cgtcacaactcgcgggtcagtgacatggtgcgcatcatcccggggctggaggacaaactt
cagaccagcagcttcaggctggaggccgatgccctggacaccaggggtaggggagacgtc
tggtga

DBGET integrated database retrieval system