KEGG   Pomacea canaliculata (golden apple snail): 112571672Help
Entry
112571672         CDS       T05881                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3-like
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    112571672
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcan03032]
    112571672
   03036 Chromosome and associated proteins [BR:pcan03036]
    112571672
   03400 DNA repair and recombination proteins [BR:pcan03400]
    112571672
Enzymes [BR:pcan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     112571672
DNA replication proteins [BR:pcan03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     112571672
Chromosome and associated proteins [BR:pcan03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    112571672
DNA repair and recombination proteins [BR:pcan03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     112571672
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PARP_reg WGR
Motif
Other DBs
NCBI-GeneID: 112571672
NCBI-ProteinID: XP_025106641
AA seq 534 aa AA seqDB search
MPPKRKAAAKNGGKAAKKRKAEETEIGKPATTQDKINALKAADKAVSRKYRPDSFIPDAT
DYEVYLDYDAMLNQTNIGQNNNKFYVIQVLKNNASTSYFSWNRWGRVGEPGQNAMKGPFA
SANDAVKDFEKKFTDKTKNKWANRDTFKSIPGKYTLIEMAGEDDAGEDTVDAGLSLQTDQ
KVSKCSLDPVTQELVKLIFDNDMFRETMQRFDIDVKKMPLGKLSKTQIAKGFEILERLEE
AVKKKSTKPTLEKLSSEFFTAIPHNFGRRLPPVIDNQEMVQQKYDMLGVLGDIEIAQSMK
NEKKENTNVSKTTNEVPNPLDVNYGLLKCTLTLVDKKSKDYKILEKYFKETKPTSSWRNL
VLREIWQVDREGEAEHFKAHDNIKERKLLWHGTNVAVVAAILKTGLRIMPHSGGRVGRGI
YFASENDKSAGYVSPAGKKGIMFLNEVAIGKQHCIYSDNPNLTTPPKGYDSVLACGTQEP
DSAYDVTLTLDGKPVVVPQAKPKQTGKSSSFYQSEYLIYKESQNRIRYLLLLDF
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgccacctaaacgtaaggctgcggctaagaatggtggaaaagcagcaaaaaagcgtaag
gctgaagaaacagagattggcaagccagccacaacacaggacaaaatcaatgctctcaaa
gctgcagacaaagctgtcagtaggaaatacaggcctgactctttcatacctgatgccact
gattatgaggtgtacctggactatgatgcaatgctgaatcagaccaatattggccaaaac
aacaataaattttatgtcatccaagtgctgaaaaataatgcatctacatcttatttttcg
tggaaccgatggggtcgtgtgggtgagccaggacaaaatgccatgaaaggtccctttgca
agtgcaaatgatgctgttaaagactttgagaagaagttcacagataaaacaaaaaacaag
tgggctaacagagacacatttaagtccatacctggcaaatacactttgattgaaatggct
ggagaggatgatgctggagaagacactgttgatgctggtctttcgctccaaactgatcag
aaggtttccaagtgctcactggatccagtcacacaggagcttgtgaaactcatctttgac
aatgacatgttccgagagaccatgcagcgctttgacatagatgtcaagaagatgcctttg
ggaaagctaagcaagacacaaatagcaaaaggttttgagattctggaaaggttggaagaa
gcagtgaagaaaaagagcacaaagccaacacttgagaaactatcatctgaattttttact
gccattccacacaacttcggtcgccggctgccacctgtgattgataaccaagagatggtc
cagcaaaaatatgatatgctaggggtcttgggagatatagaaatagctcagagcatgaag
aatgagaagaaagagaacaccaatgtcagtaagactacaaatgaagtgcctaatccgctg
gatgtgaattatggattactcaagtgcacactgacactggttgataaaaagtcaaaagat
tacaagatccttgaaaaatacttcaaggagacaaaacccactagttcttggcggaatctt
gtccttcgagagatttggcaagttgatcgtgaaggagaggcagaacatttcaaagctcat
gataacattaaggagcgtaagcttttgtggcatggtactaatgtggcagtagtagcagcc
attttgaagacaggcttgcgcatcatgcctcacagtggaggtcgagtgggccgggggatt
tactttgcatcagaaaatgacaagtctgcaggatatgtgagtccagctggcaagaagggc
atcatgtttttgaatgaagtagccataggcaagcagcactgtatttacagtgacaacccc
aatcttacaactccacccaaagggtatgacagtgtgctggcatgtggcacacaggaacca
gattcagcatatgacgtgacattaacccttgatgggaagccagttgtggtgccacaggct
aaacccaagcaaacaggcaagagcagtagtttttaccagagcgagtaccttatctataaa
gagagtcaaaaccgcattaggtacctactgctcttagacttttag

DBGET integrated database retrieval system