KEGG   Pomacea canaliculata (golden apple snail): 112571966Help
Entry
112571966         CDS       T05881                                 

Definition
(RefSeq) glutathione S-transferase DHAR1, mitochondrial-like
  KO
K21888  glutathione dehydrogenase/transferase [EC:1.8.5.1 2.5.1.18]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00053  Ascorbate and aldarate metabolism
pcan00480  Glutathione metabolism
pcan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    112571966
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112571966
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcan02000]
    112571966
Enzymes [BR:pcan01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.1  glutathione dehydrogenase (ascorbate)
     112571966
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112571966
Transporters [BR:pcan02000]
 Other transporters
  Pores ion channels [TC:1]
   112571966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 112571966
NCBI-ProteinID: XP_025107196
AA seq 258 aa AA seqDB search
MDDTNASRMCPRFIVYVKAATNGETLGDCPFCQHVCMVMFMKMPENLYIVYPVNLQRKPT
KFLELNPLGKVPVLEDTEMQVVVKESFNIVSYIHNIFPLPKMFVGYKGRAKDFCAEIFPM
LVTLLKNKDPKLRKEHLDNLLSELSKLNDYLLSYHKTGPYLLGPNLSDLDCTLLPQLRHV
LVAGHYYQNFLVPAKMVPLHMYLMHGLACKAFRRTCCPVDEIIKGWAVHKIDLIEPVKTF
QLLQKPSLKHLRHKHAKP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaccaacgcatccagaatgtgccctaggttcattgtctatgtgaaagcagca
accaatggggaaactctgggagactgtcctttctgccagcatgtctgcatggtgatgttc
atgaaaatgccagaaaatttatacatagtctacccagtgaacctacaaagaaagccaact
aaattccttgagctcaatcctctgggcaaagttccagtccttgaagacacggagatgcaa
gttgtagttaaagaatcattcaacatcgtttcatacatccataacatctttcctctgcct
aaaatgtttgtgggctacaaaggccgagccaaagatttctgtgcagaaatatttcctatg
ctggtgacattgctgaaaaacaaggatccaaaattaaggaaggagcacctagataacctg
ctttcagaactgtccaaactgaatgactacctactcagttaccataaaactggtccctac
ctcctgggacccaacctcagtgatctggactgcacactcctaccgcaacttcgtcatgtc
ttggtggctggccattattatcagaacttcttggttccagcaaagatggtgccacttcac
atgtacctaatgcatggcctcgcatgcaaggctttccgtcgcacgtgttgtcctgtcgac
gaaatcatcaagggctgggctgtccataagattgacctgattgagcctgtgaagactttc
caacttctccagaagccctctttaaaacatctgcggcacaagcatgctaagccctaa

DBGET integrated database retrieval system