KEGG   Parolsenella catena: Pcatena_09820
Entry
Pcatena_09820     CDS       T05797                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
pcat  Parolsenella catena
Pathway
pcat00230  Purine metabolism
pcat01100  Metabolic pathways
pcat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcat00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Pcatena_09820
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: BBH50395
UniProt: A0A3G9KAT4
Position
complement(1077773..1078267)
AA seq 164 aa
MDMKILKCTVNGKEVQVGYDPRESLLDTLRNRLGLTSVKRGCEVGECGACTVLIDGVATD
TCLYLTDWAQGKDILTVEGLQAPDGTLNPVQQAFIDQFAVQCGFCIPGIIMSAMEMINTG
KTYTRDEIRKNLSGHLCRCTGYQNVIDGVEKAIEIVHGECGTEE
NT seq 495 nt   +upstreamnt  +downstreamnt
atggacatgaagatcttgaagtgcacggtgaacggcaaggaagtccaggtgggctatgac
ccgcgcgagtcgctgctcgacacgctgcgaaaccgcctgggcctcacgagcgtcaagcgc
ggctgcgaggtgggcgagtgcggtgcctgcaccgtgctcatcgacggcgtggccacagac
acctgcctctacctcacggactgggctcagggcaaggacatcctcaccgtcgagggcctg
caggcgcctgacggcacgctcaaccccgtccagcaggcgttcatcgaccagttcgccgtc
cagtgcggcttctgcatccctggcatcatcatgagcgccatggagatgatcaacaccggc
aagacctacacccgagacgagattcgcaagaacctctcgggacacctgtgccgctgcacc
ggctaccagaacgtaatcgacggcgtcgagaaggccatcgagatcgttcacggcgagtgc
ggaaccgaggagtag

DBGET integrated database retrieval system