KEGG   Plasmodium chabaudi: PCHAS_130700Help
Entry
PCHAS_130700      CDS       T01108                                 

Gene name
PC000375.03.0
Definition
(RefSeq) triosephosphate isomerase, putative
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcb  Plasmodium chabaudi
Pathway
pcb00010  Glycolysis / Gluconeogenesis
pcb00051  Fructose and mannose metabolism
pcb00562  Inositol phosphate metabolism
pcb01100  Metabolic pathways
pcb01110  Biosynthesis of secondary metabolites
pcb01130  Biosynthesis of antibiotics
pcb01200  Carbon metabolism
pcb01230  Biosynthesis of amino acids
Module
pcb_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCHAS_130700 (PC000375.03.0)
   00051 Fructose and mannose metabolism
    PCHAS_130700 (PC000375.03.0)
   00562 Inositol phosphate metabolism
    PCHAS_130700 (PC000375.03.0)
Enzymes [BR:pcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PCHAS_130700 (PC000375.03.0)
Exosome [BR:pcb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PCHAS_130700 (PC000375.03.0)
  Exosomal proteins of bladder cancer cells
   PCHAS_130700 (PC000375.03.0)
  Exosomal proteins of melanoma cells
   PCHAS_130700 (PC000375.03.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM CutC DUF2521 M60-like_N DrsE
Motif
Other DBs
NCBI-GeneID: 3497412
NCBI-ProteinID: XP_744298
UniProt: A0A077TNJ9
Position
13
AA seq 248 aa AA seqDB search
MARKYFVSANWKCNGTKDSIKTLADSFNTVDFDPSKLDVVVFPVSVHYDLARNLLNKKIG
TGIQNVSKFGNGSYTGEVSAEIAKNLDIEYVLIGHFERRKYFHETDEDVREKLQQAIKHN
LKAVVCFGESLEQRESNKTIEVITKQVKAFVDLIENFDNVILAYEPIWAIGTGKTATPEQ
AQEVHKEIRKIVKEICGEAQANKIRILYGGSVSVENCTSLIKQEDIDGFLVGTSSLKTSF
TEIIKSAM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaaatattttgtatctgctaactggaaatgtaatggtaccaaagatagtata
aaaactttggcagacagttttaatacagtggactttgacccaagcaaactagatgtcgtt
gtattccctgtaagcgtacactatgatctcgctagaaacttattaaataaaaaaatcgga
actggtattcaaaatgtttcaaaatttggaaatggttcatatactggtgaagttagtgca
gaaattgcaaaaaacttagacatcgaatatgttctaattggccattttgaaagaaggaaa
tactttcatgaaactgatgaagatgtaagggaaaaattacaacaagctatcaaacataat
ttaaaagcggttgtatgttttggtgaatcactagaacaaagagaatccaataaaactatc
gaagtaatcacaaaacaagtaaaagcttttgttgatttaattgaaaattttgataatgtc
atattagcttatgaacctatatgggctattggaaccggaaaaacagccacaccagaacaa
gcacaagaggttcataaagaaattagaaaaattgtaaaagaaatatgcggcgaagctcaa
gcaaataaaatcagaattttatacggaggtagtgttagtgttgaaaattgtacttcatta
attaaacaagaagacatcgatggattcttagttggaacaagctcattaaagacctcgttc
accgaaattataaaatctgccatgtaa

DBGET integrated database retrieval system