KEGG   Plasmodium chabaudi: PCHAS_072100Help
Entry
PCHAS_072100      CDS       T01108                                 

Gene name
PC000186.01.0
Definition
(RefSeq) heat shock protein, putative
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
pcb  Plasmodium chabaudi
Pathway
pcb03040  Spliceosome
pcb04141  Protein processing in endoplasmic reticulum
pcb04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:pcb00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    PCHAS_072100 (PC000186.01.0)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PCHAS_072100 (PC000186.01.0)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    PCHAS_072100 (PC000186.01.0)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcb01009]
    PCHAS_072100 (PC000186.01.0)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pcb03041]
    PCHAS_072100 (PC000186.01.0)
   03009 Ribosome biogenesis [BR:pcb03009]
    PCHAS_072100 (PC000186.01.0)
   03110 Chaperones and folding catalysts [BR:pcb03110]
    PCHAS_072100 (PC000186.01.0)
   04131 Membrane trafficking [BR:pcb04131]
    PCHAS_072100 (PC000186.01.0)
   03051 Proteasome [BR:pcb03051]
    PCHAS_072100 (PC000186.01.0)
   03029 Mitochondrial biogenesis [BR:pcb03029]
    PCHAS_072100 (PC000186.01.0)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcb04147]
    PCHAS_072100 (PC000186.01.0)
Protein phosphatases and associated proteins [BR:pcb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PCHAS_072100 (PC000186.01.0)
Spliceosome [BR:pcb03041]
 Complex B
  Other components
   Prp19 complex
    PCHAS_072100 (PC000186.01.0)
 Complex C
   Prp19-CDC5 complex
    PCHAS_072100 (PC000186.01.0)
Ribosome biogenesis [BR:pcb03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    PCHAS_072100 (PC000186.01.0)
Chaperones and folding catalysts [BR:pcb03110]
 Heat shock proteins
  HSP70 / DNAK
   PCHAS_072100 (PC000186.01.0)
Membrane trafficking [BR:pcb04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    PCHAS_072100 (PC000186.01.0)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    PCHAS_072100 (PC000186.01.0)
Proteasome [BR:pcb03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PCHAS_072100 (PC000186.01.0)
Mitochondrial biogenesis [BR:pcb03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    PCHAS_072100 (PC000186.01.0)
Exosome [BR:pcb04147]
 Exosomal proteins
  Proteins found in most exosomes
   PCHAS_072100 (PC000186.01.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A DDR DUF5581
Motif
Other DBs
NCBI-GeneID: 3494692
NCBI-ProteinID: XP_741609
UniProt: A0A077TNY2
Position
7
AA seq 678 aa AA seqDB search
MANAKASKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQGNRTTPSYVAFTDTER
LIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGIEEKPMIEVVYQ
GEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLN
VMRIINEPTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHL
GGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRTQCERAKRTLSSSTQATIEIDSL
FEGIDYSVTVSRARFEELCIDYFRDTLIPVEKVLKDAMMDKKSVHEVVLVGGSTRIPKIQ
TLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSNAVQDLLLLDVCSLSLGLETAG
GVMTKLIERNTTIPAKKSQIFTTYADNQPGVLIQVYEGERALTKDNNLLGKFHLDGIPPA
PRKVPQIEVTFDIDANGILNVTAVEKSTGKQNHITITNDKGRLSPEEIDRMVNDAEKYKA
EDEENKKRIEARNSLENYCYGVKSSLEDQKIKEKLQPSEIETCMKSVTSILEWLEKNQLA
GKDEYEAKQKEAESVCSPIMSKIYQDAGAAAGGMPGGMPGGMPGGMPGGMNFPGGMPGGM
GAPGGAPAGSGPTVEEVD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgcaaaagcatcaaagccaaatttaccagagtcaaacatcgctataggtatc
gatttaggtaccacttactcctgtgttggtgtatggagaaatgaaaatgttgatataatt
gctaacgatcaaggtaacagaacaaccccatcctatgttgctttcactgatacagaaaga
ttaattggtgatgcagctaaaaatcaagttgcaagaaatccagaaaatacagtcttcgat
gcaaaaagattaataggaaggaaatttacagaatcttcagtacaaagtgatatgaaacac
tggccatttacagtcaaatcaggtattgaagaaaaacctatgattgaagttgtttatcaa
ggtgagaaaaaattatttcaccctgaagaaatttcttctatggttttacaaaaaatgaaa
gaaaatgcagaagcctttttaggaaaatctataaaaaatgccgtcatcacagtacctgca
tattttaacgattctcaaaggcaagcaacaaaagatgctggtacaattgcaggattaaat
gttatgagaattataaatgaaccaactgcagcagctattgcatatggtttacacaaaaaa
ggaaaaggagaaaaaaatattttaattttcgatttaggaggtggtacttttgatgtttca
ttacttactattgaagatggtatattcgaagttaaagcaacagcaggagatacccattta
ggtggtgaagattttgataaccgtttagtaaacttttgcgttgaagattttaaaagaaaa
aatagaggcaaagatttatcaaaaaatagtagagctttaagaagattaagaacacaatgt
gaaagagcaaaacgtaccttatcttcttcaactcaagcaacaattgaaattgattctctt
tttgaaggtattgattatagtgtaacagttagtagagctagatttgaagaattatgtatt
gactattttagagatacattaatacctgttgaaaaagttttaaaagatgccatgatggac
aaaaagagtgttcatgaagttgtcttagttggtggatctacaagaattccaaaaattcaa
acattaataaaagaattctttaatggtaaagaagcatgcagatcaatcaatcctgatgaa
gctgttgcttatggtgctgctgtccaagccgccattttatcaggtgatcaatccaatgca
gtacaagatttattattattagatgtctgttccttatctttaggattagaaactgcagga
ggtgttatgacaaaattaattgaaagaaatacaacaattccagccaaaaaaagtcaaatt
tttaccacctatgctgataatcaaccaggtgtgttaatacaagtatatgaaggagaaaga
gccttaaccaaagataataacttattaggtaaatttcatttagatggtattccacctgct
cctagaaaggttccacaaattgaagttacctttgatattgatgcaaatggtatcttaaat
gtcacagctgttgaaaaaagtactggtaaacaaaatcatatcaccattactaatgacaaa
ggtagattatctcctgaagaaattgatagaatggttaatgatgctgaaaaatataaagca
gaagatgaagaaaataaaaaaagaattgaagcaagaaacagtcttgaaaactattgctat
ggtgttaaaagttcattagaggatcaaaaaattaaagaaaaattacaaccaagtgaaatt
gaaacctgtatgaaatctgttacttctatccttgaatggttagagaaaaaccaattagct
ggaaaagatgaatatgaagctaagcaaaaagaagctgaatctgtatgctcaccaattatg
tctaaaatatatcaagatgctggagcagctgctggcggaatgcccggtggaatgccaggt
ggaatgccaggaggtatgccaggaggtatgaacttcccaggtggaatgcccggaggtatg
ggagcacctggaggagcaccagctggaagtggaccaactgttgaagaagttgattaa

DBGET integrated database retrieval system