KEGG   Plasmodium chabaudi: PCHAS_142310Help
Entry
PCHAS_142310      CDS       T01108                                 

Gene name
PC000698.02.0
Definition
(RefSeq) 4-nitrophenylphosphatase, putative
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
pcb  Plasmodium chabaudi
Brite
Enzymes [BR:pcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     PCHAS_142310 (PC000698.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase PGP_phosphatase Acid_phosphat_B
Motif
Other DBs
NCBI-GeneID: 3499012
NCBI-ProteinID: XP_016654898
UniProt: A0A4V0KDI0
Position
14
AA seq 314 aa AA seqDB search
MSLIVSEANQNSCNSFMKEWKIEHKVNAKDLYQNFEVFFFDCDGVLWRGDTVINGAIELV
NKLISDNKKVYFITNNSTKSRDTLLRRFHKLGFTCVKTENIICTSYAVAKYFHSKEEYKS
RQKKIYVIGEKGICDELDALDLDWLGSYKDNDKKVVISDEGEIQIDNNIGGVVVAIDFSI
NYYKIQYAQLCINTLDAEFIVSNTDPLANFTSNQQWAGTGSIVASVERVSFKKPKVLGKP
NLFMVESVLKNLNIDLSKVVMIGDRLDTDIYFAQNCKMKSILVFSGITDANVFLNHNNLN
IKPDYFMTSIKEFL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaatcgtttctgaggctaaccaaaatagctgtaacagttttatgaaagaatgg
aaaatcgaacacaaggtaaatgcaaaagacctttatcaaaattttgaagttttctttttt
gattgtgatggggttttatggagaggggatacagttattaatggagcaatagaattagtt
aacaagctaattagtgataataaaaaagtttattttattacaaataattcgactaaatcg
agagatacattgttaagaagatttcataaattaggatttacttgtgttaaaaccgaaaat
attatttgcacatcttatgcagttgctaaatattttcatagcaaagaagaatataaatcg
agacaaaaaaaaatttatgtaattggagaaaaggggatatgtgatgaattagatgcttta
gatcttgattggttaggtagctataaagataatgataaaaaagttgttataagtgatgaa
ggagaaatacaaatagataataatattggaggtgttgttgttgcaattgattttagtatt
aattattataaaattcaatatgcccaactttgtataaataccttagatgcagaatttatt
gtatctaacacagatccccttgcaaattttacatcaaaccagcaatgggctggtacggga
tcaattgttgcttctgttgaaagagtatcttttaaaaaacctaaagtgctaggaaagcca
aatttatttatggttgaatccgtgttaaaaaatcttaacattgatttatcaaaagttgtt
atgataggtgatagattagatactgatatatattttgctcaaaactgcaaaatgaaatcg
atacttgttttttctggaattaccgatgcgaatgtttttttaaatcataataatttaaat
attaaacctgattattttatgacttctattaaggaatttttataa

DBGET integrated database retrieval system